optional Stadt:

Reise › Irland Reisen Angebot Schweiz

Reise


Google Anzeige:



Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


1 Ferien in Irland Reisebüro ch

shamrock-reisen hat es sich zum Ziel gesetzt auf Ihre Wünsche massgeschneiderte Reisen nach Irland Ihrem Budget angepasst zu realisieren. Wir...
irlandferien.ch Irland Reisen Angebot Bootsferien Reise Rundreisen Mietwagen Spezialist Rundreise Tage Golfreisen Schweizer Themenreisen Organisation Landschaft Frühbucher Ihr
2 Clever online bewerben Jobs und ch

Über 20 Millionen Deutsche sind ständig im Internet unterwegs - nur um einen Job zu suchen. Und es werden täglich...
beste-ratgeber-ebooks.com Hinzufügen Wunschliste Geld Partnersuche Beiträge Ratgeber Haustiere Reise Touristik Gesundheit Schönheit Marek Verdienen Dvonc Flirt Job
3 World Wide Wheels AG Reise ch
8303
Bassersdorf
Die World Wide Wheels AG ist ein auf die Vermietung von Wohnmobilen spezialisiertes Reiseunternehmen. Wenn Sie ein Reisemobil im In-...
world-wide-wheels.com Wohnmobil Caravan Camper Mieten Anfordernrichtig Wheels Wide Möchten |world Offerte Vermietung
4 Gutscheine Gewinnspiele sowie Online-Shops aller Art Gutscheine Gewinnspiele sowie Online-Shops Werbeagentur ch
8741
Weißkirchen in Steiermark
Discount Portal bietet seriöse, geprüfte Gutscheine und Gewinnspiele an, die täglich aktualisiert und ergänzt werden. Nebenbei werden Online-Shopping sehr leicht gemacht...
discountportal.at Gewinnspiele Gutscheine Portal Reise Discount Urlaubsportale Besten Testen Gratisprodute Z
5 Paramon-Verlag Verlag ch
6300
Zug
Gute Autoren müssen nicht auch gute Lektoren, Buchsetzer, Grafiker, Vertriebsmitarbeiter oder Werbefachleute sein. Wir unterstützen Sie als Partner und bringen...
paramon.ch Verlag Paramon Krimi Landkarte Kinderbuch Manuskript Belletristik Buch Fantasy Einsatz Hilfe Werbung Sachbuch Reise Philosophie
6 Kilimanjaro Trekking Reise ch
8154
Oberglatt
Reiseangebote in die Hochgebirgswelt umrahmt von wilder Natur. Begleitet von geprüftem Schweizer Bergführer mit langjähriger Erfahrung. Die Reisen...
derberg.com Korsika Klettern Kilimanjaro Trekking Nepal Weissmies Trekkings Verkehr Besteigung Elbrus Cevennen Bergfuehrern Lawinen Bergtouren Wetter
7 Partnerzusammenführung - Partnerrückführung - Liebeszauber Partnerzusammenführung - Partnerrückführung - Esoterik ch
1201
Genf
Die AGW Akademie der geistigen Wissenschaften ist das führende Institut im Markt der Esoterik. Wir helfen Ihnen Ihren Partner nach...
agw-akademie.com Partnerrückführung Partnerzusammenführung Liebeszauber … Navigation Schweiz Agw Gewichts Geistigen Erfolgs Befreiung Vitalregulierung überspringen Analyse Reise Abhänigkeiten Studium
8 Dapur Indonesia Restaurant ch
8050
Zürich
Lust, eine andere asiatische Küche auszuprobieren? Dann kommen Sie zu uns ins Dapur Indonesia, dem einzigen reinen indonesischen Restaurant in Zürich! Machen...
dapur-indonesia.jimdo.com/ Indonesia Restaurant Dapur Zürich Presse Indonesien Jobs Uhr  Menu Mail Keine Fr  Reise Schaffhauserstrasse Bearbeiten
9 Sinici Reisen Sinici

Sinici Reisen ... HOTELS ANTALYA ALANYA KUSADASI SIDE BLAUEREISEN RUNDREISEN STÄDTEREISEN MIETWAGEN SINICI REISEN
sinici-reisen.ch Sinici Reisen
10 Individuelle Reisen weltweit | Reisen

Weltweite Reisen individuell zusammenstellen. MESO Reisen Ihr Reiseveranstalter für Fernreisen. ... Individuelle Reisen weltweit Reisebüro Alternativ Tours GmbH Ihr Reiseziel Flüge Kontakt News
alternativ-tours.ch Reisen Individuell MESO Reisen MESO Reisen Berlin Weltweit
11 ClubReisen: Hier finden Sie ClubReisen

ClubReisen: Finden Sie aktuelle Angebote zu ClubReisen. Viele Infos und alle Angebote. Sparen Sie bis ...  Club-Reisen Hier finden Sie alles zu Club-Reisen Club-Reisen Club Aldiana Club Robinson Club
club-reisen.ch ClubReisen
12 Köppel Reisen AG || Reisen

Käppel Reisen AG ... Reisen - seit Entdecken Sie die Welt ! Jahre Reisebüro Köppel – Ein spannendes und interessantes
koeppel.ch Reisen Carreisen
13 Comet Reisen Comet

Reise Anbieter Südamerika ... Comet Reisen Peter Koch Geschäftsführer spezialisierte sich auf Mittel- und Südamerika und weitete
cometreisen.ch Comet Reisen Südamerika Mittelamerika
14 Reiseberatung Kanada Reisen Reiseberatung

Reiseberatung Kanada Reisen Südafrika Reisen USA Reisen fair trade Reiseberatung.ch ... ich habe sie genossen gelebt war wieder unterwegs auf meinen eigenen Reisen. Die Homepage Reiseberatung stelle
reiseberatung.ch Reiseberatung Kanada Reisen Südafrika Reisen
15 Sibirien Reisen sibirien
6102
Malters LU
Reisen durch Sibirien Russland mit Pajechali Reisen. Erleben Sie Russland mit dem LKW hautnah. ... Tunka-Tal Barguzin-Tal Dzhida-Bezirk Heilige Nase Olchon Infos Reise Blog Reisedaten Routen Info
pajechali-reisen.ch Sibirien Reisen Russland
16 Reisen von Ruth Reisen

Reisen Ruth und René Brunner ... Contacts Home News Feeds Unsere Reisen Reise Fotos Bilder unserer Reisen Tagesberichte unserer
rene-brunner.ch Reisen USA Reise Norden Reise
17 Reise Info Welt Reise

Reise Info Welt Das ReiseInfoportal ... Reise Info Welt Infos zu allen Reisearten Home Hinweis AGB Insider-Reiseinfos Reisen
reise-info-welt.ch Reise Reisen Urlaub Ferien
18 Lateinamerika Reisen Südamerika Lateinamerika

Buchen Sie Ihre Lateinamerika Reise beim Spezialisten! Gerne erstellen wir Ihnen ein Angebot für Ihre ... Eine Reise durch Chile Wüste Wein und weites Land News aus Lateinamerika Interessanter Artikel in der Zeit
latintravels.ch Lateinamerika Reise Südamerika Reise
19 Reisebausteine Reisen weltweit reisebausteine

Auf Reisebausteine.de finden Sie mehr als 6000 Angebote und Reise Ideen weltweit preiswert und mit ... ..... gleich geht es weiter zu den Reise Angeboten auf reisebausteine
reisebausteine.ch Reisebausteine Reisen Reise Urlaub
20 Lastminute Reise lastminute

Last Minute Ferien zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ... Sie uns an unter Suche anpassen Früheste Anreise Späteste Rückreise Abflughafen beliebig
lastminute-reise.ch Lastminute Reise
21 Bachmann Reisen Startseite Bachmann Reisen GmbH bachmann
6110
Wolhusen
Bachmann Reisen GmbH Aus Freude am Reisen ... Online-Katalog Bachmann Reisen GmbH Spitalring CH- Wolhusen Telefon + Tele +
bachmann-reisen.ch Bachmann Reisen Tagesfahrten Rundreisen
22 Eurotop Reisen Ihr Sardinienspezialist Sardinien

Eurotop reisen Ihr sardinienspezialist in der Schweiz ... Eurotop Reisen Ihr Sardinienspezialist Direkt zum Seiteninhalt Hauptmenü Homepage Hotels
eurotopreisen.ch Sardinien Eurotop Eurotop Reisen Eurotopreisen Mobylines Sardiniaferries
23 RISA Reisen | Reisen gruppenreise
40233
Düsseldorf
RISA Reisen ? Ihr Reiseveranstalter für Südamerika! Hier finden Sie Ideen für Reisen im Mietwagen ... + - inforisa-reisen RISA Reisen Reisen in Südamerika
risa-reisen.ch Gruppenreise Rundreise Reiseveranstalter Suedamerika Reisen Mietwagen Klei
24 Im Seekajak auf Reisen seekajak

Seekajak Reisen sind Aktiv Reisen mit einem Schuss Abenteuer. Im Seekajak kommt ihr an entlegene ... Seekajaktouren - Europa weltweit Start Im Kajak reisen? Seekajakreisen ? für wen? Seekajak
fjordtravel.ch Seekajak Seekajakreisen Aktiv Reisen Aktives
25 Onlineweg.de Last Minute onlineweg.de Touristik GmbH last
81373
München
Last Minute Reisen mit persönlicher Beratung buchen ? günstige Reisen buchen ? Pauschalreisen mit Bestpreisgarantie ... Kreuzfahrten Ausflüge Kurzreisen Last Minute Last-Minute Reisen Reisen bis EUR - Pauschalreisen Günstige
onlineweg.ch Last Minute Reisen Last Minute Urlaub
26 Carreisen Europapark mit UND TRANSPORTE AG Carreisen
8854
SIEBNEN
Carreisen Europapark mit dem Car Carfahrten Europapark Reisen Mächler Reisen ... Startseite Last Minute Reisen Reise suchen MÄCHLER REISEN UND TRANSPORTE AG GLARNERSTRASSE
maechler-reisen.ch Carreisen Europapark Mit Dem Car Carfahrten
27 Vorbereiten planen und Individual

Individual Reisen nach China der Guide für Reisen auf eigene Faust in die Volksrepublik ... Alles rund ums Reisen in China Home Reiseziele Beijing Hainan Hong Kong Shanghai Rundreisen Region
nachina.ch Individual Reisen China
28 Alma Reisen Alma
3097
Liebefeld
ALMA Reisen zu sich selber. Und wer hätte nicht Lust seine Seele baumeln ... erforderlich. Alma Alma Reisen ALMA Incentive Almavida Events Almadentro Seminare ALMA Foto Galerien Alma Blog
alma-reisen.ch Alma Reisen Singles Singlereise Reise
29 Reisen mit Profil westalpen

Das ist eine Reiseund Offroad Website. ... Reisen mit Profil Direkt zum Seiteninhalt Hauptmenü Home Aktuell Ueber uns unser Reiseblog
reisenmitprofil.ch Westalpen Reisen Profil Offroad 4x4 Allrad Toyota Landcruiser
30 DiscountReisen Ferien und Pauschalreisen
5040
Schöftland
DiscountReisen das Ferien Reiseportal für ReiseSchnäppchen und Billigflüge günstige Pauschalreisen Ferienreisen ... Reisen und Ferien günstig beim Discounter buchen Ferien buchen Discount-Reisen bietet Ferien
discount-reisen.ch Pauschalreisen All Inclusive Reisen Last Minute
31 Reisen Onund Offroad Reisen

Reisen Onund Offroad ... Reisen On-und Offroad Direkt zum Seiteninhalt Hauptmenü Home
pajero.ch Reisen Travel Dogde Durango
32 Ozeanien Reisen Ozeanien Ozeania Reisen AG Ozeanien
5442
Fislisbach bei Baden
Ozeanien Reisen Ozeanien Reise Australien Reisen Ozeania Reisen AG
ozeania.ch Ozeanien Reisen Ozeanien Reise Australien Reisen
33 Roki Reisen Herzlich Roki
3627
Heimberg
Roki Reisen: Ihr Anbieter für individuelle Reisen und Tagesausflüge! Suchen Sie einen Car für einen ... Partner Herzlich Willkommen bei Roki Reisen Es freut uns dass Sie uns auf unserer Webseite besuchen
rokireisen.ch Roki Reisen Car Ausflug Berner
34 Die Reisen in der Die

Reisen in der Schweiz finden Sie auf Swissportail die Informationen mit 2 Mausclick! ... Sie suchen Reisen in der Schweiz. Klicken Sie auf einen der registrierten Einträge
die-reisen.ch Die Reisen Reise Suisse Schweiz Swissportail
35 KübliReisen KübliReisen

KübliReisen
kuebli-reisen.ch KübliReisen
36 Last Minute Reisen Angebote Holiday Smart GmbH Last
45127
Essen
Last Minute Reisen Angebote im Überblick von allen Veranstaltern finden Sie hier. Ihr ... Last Minute Reisen Angebote Last Minute Reisen Angebote können Sie ganz einfach hier vergleichen
reisen-ab-flughafen.ch Last Minute Angebote Last Minute Reisen Angebote
37 Reisen direkt Reisen Ferien ferien

Ferien und Reisen zu Schnaeppchen Preisen reisedirekt: Direkt buchen direkt sparen. Grosser Reise und ...  Reisen direkt Reisen Ferien buchen - direkt sparen Inline HTML Online Reiseanfrage oder Live
lastmin.ch Ferien Reisen Urlaub
38 Reisen mit dem Rollstuhl Rollstuhl

Tetraplegiker macht seine Erfahrungen beim Reisen in Hotels und an Stränden ... " auch die Suche nach Reise- und Ferienmöglichkeiten. Dass dies nicht immer einfach ist trotz Internet
aleri.ch Rollstuhl Behindertengerecht Reisen Handycapreisen Rollstuhlfreundliches Hotel
39 Meyer Reisen Reiden Meyer

Meyer Reisen Gmbh Messereisen ... Willkommen bei Meyer Reisen
meyer-reisen.ch Meyer Reiden Reisebuero Reisen
40 Vatan Reisen Vatan
8003
Zürich
Vatan Reisen Tickets Flugtickets Türkei Istanbul Izmir Antalya ... Vatan Reisen Skip to content Home Istanbul Marmara Istanbul Stadt Istanbul Stadtrundfahrt
vatan.ch Vatan Vatan Reisen Bilet Zürih
41 Piato Reisen Schweiz Piato

Homepage des Reisebüros Piato Veranstalter von qualitativ hochstehenden Reisen zu vernünftigen Preisen ... Piato Reisen Schweiz - Falera - Incentive Reisen - Individual Reisen - Pauschal/Gruppenreisen
piato.ch Piato Reisen Incentive Reisen Individual Reisen
42 Relaxed Reisen Reisen

Relaxed durch die Schweiz reisen. Persönliche Begleitung an Ihren Wunschort in der Schweiz. Ich organisiere ... Relaxed Reisen in der Schweiz Menü Startseite Reisevorschläge Photos Wissenswertes Philosophie
relaxed-reisen.ch Reisen Schweiz Engadin Brienzer Rothorn
43 Reise Portal von partner4all.ch Urlaub

Buchen Sie günstig Reisen Reisen und Urlaub mit Tiefpreisgarantie bei www.partner4all.ch ...  Reise Portal von partnerall
partner4all.ch Urlaub Reisen Lastminute Flugreisen
44 Bossart Reisen AG Glattbrugg Bossart Reisen AG Bossart
8152
Glattbrugg
Die schönsten Busreisen 2015 ::: Bossart Reisen AG ... Willkommen bei Bossart Reisen AG Jetzt ist er da! Bestellen Sie hier unseren druckfrischen
bossartreisen.ch Bossart Reisen Bus Busreisen Car
45 Kaiser Reisen AG Weiningen reisen

Kaiser Reisen AG ist Anbieter von Reisen klein aber fein. ... Willkommen KAISER REISEN AG BadenerstrassePostfach CH- Weiningen +
kaiser-reisen.ch Reisen Geschäftsreisen Reisebüro Privatreisen
46 Winner Tennis Golf Tennis

Winner Tennis Golf Reisen ... Winner Tennis Golf Reisen Optimized for Internet Explorer - mind x Resolution Required
winner-reisen.ch Tennis Golf Reisen Golfstunden
47 Mavi Reisen Ihr Mavi

Mavi Reisen Ihr Partner für Türkei Reisen in der Schweiz ... MR Mavi Reisen Ihr Partner für Türkei Reisen MR Mavi Reisen Kasernenstrasse Liestal
mavireisen.ch Mavi Mavi Reisen MR Mavi Reisen
48 Ecautozug.ch Autozug bequemes autozug
6343
Rotkreuz
ecautozug beqeuemes reisen erholt ans Ziel kommen mit den Autozuuml;gen ... reisen ecautozug - bequemes Reisen Mit ecautozug erfahren Sie wie und wo Sie bequem mit dem Auto
ecautozug.ch Autozug Aurozüge Reisen Abfahrtsort
49 Golfreise Golf Reise mit Golfreise

Ihr Golfreise buchen Sie bei Alpha Golftours. Die perfekte Golf Reise an die schönsten Destinationen. ... HOME GOLFREISE GOLF REISE GOLFFERIEN GOLF FERIEN GOLFURLAUB GOLF URLAUB GOLFURLAUB GOLF MALLORCA
golfferien-golfreisen-golfurlaub.ch Golfreise Golfreise Golf Reise Golf Reise
50 BSR Reisen AG Reisebüro

BSR Reisen AG ist Ihr lokaler Ansprechpartner für Ferien und Reisen ... Menu Suche Erweiterte Suche Icon Druckerfreundlich reisegarantie tts Qualität auf Reisen
bsr.ch Reisebüro Ferien Flüge Rundreisen
51 TopflyPaul WolfsgruberLast Minute Reisen Topfly Reiseveranstaltungs GmbH LastMinuteReisen
80802
München
LastMinuteReisen buchen Last Minute Reisen lastminuteReisen LastminuteReisen LastminuteReisen ... DOGTRAVEL LAST MINUTE PAUSCHALREISE Kontakt Privatjets Topfly Last Minute Reisen Last Minute
topfly.ch LastMinuteReisen LastMinuteReisen Last Minute Reisen LastminuteReisen Lastminute
52 Reisenlinks.ch Die Reisen Whirli GmbH reisenlinks.ch
8953
Dietikon
reisenlinks.ch Die Reisen Suchmaschine für die Schweiz hier finden Sie: Last Minute Reisen ... reisenlinks - Die Reise Suchmaschine der Schweiz - hier finden Sie Lastminuteangebote Hotel Flüge
reisenlinks.ch Reisenlinks.ch Reisen Suchmaschine Schweiz
53 Willkommen bei Andino Reisen Andino Reisen GmbH Kanureisen
5000
Aarau
Andino Reisen GmbH ... Mo-Fr -- Sa - + Andino Reisen GmbH Tellistrasse
andino.ch Kanureisen Kanuferien Kanutour Kanutouren
54 Steiner Reisen Messen Reisen
3254
Messen
Reisen Reisebüro Steiner Messen Postauto ... Steiner Reisen Messen Direkt zum Seiteninhalt Hauptmenü Home Wir über uns Das Team
kleinbusvermietung.ch Reisen Reisebüro Steiner Messen Postauto Bern
55 Home WeitsprungReisen behindertenreisen

Reisen mit Begleitung in die ganze Welt ... Home Wir über uns Service Kontakt Reisen mit Begleitung in die ganze Welt Weitsprung
weitsprung-reisen.ch Behindertenreisen Bildungsurlaub Behindert Ambulante Krankenpflege
56 Reisen und Rundreisen in Portugal
6020
Emmenbrücke
Reisen in Portugal sind vor allem wegen dem ganzjährigen milden Klima in der Algarve immer ... Über Reisen Gruppenreisen Reisen auf dem Wasser Städtereisen Barrierefreies Reisen Aktiv- und Wellnessreisen
portugalservice-travel.ch Portugal Reisen Rundreisen Portugal Algarve Reisen
57 Fuchs Reisen | Zufrieden Roman

Die offizielle Homepage von FuchsReisen. Roman Fuchs organisiert Vereins Gesellschafts Firma und HochzeitsCarfahrten. ... Fuchs Reisen Zufrieden Reisen Skip to content Zufrieden Reisen Eigene Stretchlimousine HauptmenÃ
fuchsreisen.ch Roman Fuchs Reisen Freienbach
58 Frossard Reisen Basel fcbontour

frossard reisen offizieller Fanreiseorganisator des FCB ... Willkommen auf der Internetseite von Frossard Reisen! Kein Anstehen kein Auto- oder Trämmlifahren
frossard-reisen.ch Fcbontour Frossard Tour Reisen
59 USA West Reisen USA

USA West Reisen Oregon Reisen Rundreise USA Westen ... USA West Reisen Oregon USA - USA West Reisen Direkt zum Seiteninhalt Hauptmenü × Homepage
oregon-reisen.ch USA West Rundreise West USA Reisen
60 Reisen mit Hefti GmbH Reisen

Reisen mit Hefti Ihre kreative Carreise ... Willkommen in der «Welt von Erlebnisreisen». Wir bieten mehrtägige Reisen in ganz Europa
reisenmithefti.ch Reisen Hefti Carreise Europa
61 Oldtimerfahrt Reisen wie Oldtimerfahrt

Oldtimerfahrt bietet Reisen wie vor 40 Jahren in einem alten Postauto an. ... oldtimerfahrt Vor Jahren Fahrzeug Kontakt Reisen wie vor Jahren! Ruhiger ging
oldtimerfahrt.ch Oldtimerfahrt Oldtimer Fahrt Ausfahrt
62 ***/ 4x4REISEN.ch : 4x4 4x4

4x4 4WD OFFROAD REISEN Schweiz : gefuehrte Reisen zu folgenden Destinationen (Auswahl) : Island Sahara ... xREISEN Geführte x Reisen für Selbstfahrer und Selbstversorger Norwegen-Gletscher-Reisen
4x4reisen.ch 4x4 4WD OFFROAD REISEN Schweiz
63 Treffpunkt Orient Reisen Treffpunkt

TreffpunktOrient.ch Reisen mit Werner van Gent ... Home Reisen so wie... Aktuelles UNSERE ORIENT-PERLEN    - Oman Sansibar    - Vom Ararat
treffpunktorient.ch Treffpunkt Orient Werner Van Gent Kultur Reisen
64 Kirgistan Reisen Kirgistan

Reisen nach Kirgistan   Neu: Man kann im Jahr 2015 mit einem professionellen ... zur Hauptnavigation und Anmeldung Nav Ansichtssuche Navigation Suchen Kirgistan Reisen Über uns Kontakt FAQ Sitemap
tripxglobe.ch Kirgistan Kirgisistan Kirgisien Kyrgyzstan
65 Rolf Meier Reisen: Ferien Ferien

Rolf Meier Reisen 8201 Schaffhausen: Ferien und Reisen auch online buchen HochzeitsReisen Aktivferien ... . bis .h Rolf Meier Reisen Vorstadt CH- Schaffhausen +
rmr-reisen.ch Ferien Reisen Online Buchen HochzeitsReisen Aktivferien
66 KOLIBRIREISEN \ Karibik Urlaub Reisen
79106
Freiburg i. Brg.
Reisen in einer anderen Karibik Trinidad Tobago ... Reisen in einer anderen Karibik - Trinidad Tobago Home Trinidad Infos Tobago Infos Photogalerie
trinidad.ch Reisen Karibik Trinidad Tobago "Trinidad Tobago" Individualreisen
67 Willkommen auf trainingscamps.ch Royal
8302
Kloten
royal sportreisen: organisiert alle Eintrittskarten und Reisen zu Sportevents ihrer Wahl Fussball Tennis ... auf Mallorca resp. in dieser schönen Anlage. Perfekte Organisation/Betreuung durch Royal Reisen gutes Essen
trainingscamps.ch Royal Reisen AG
68 Travelan Geld verdienen ADENION GmbH Geld
41515
Grevenbroich
Viel Geld verdienen mit Reise Partnerprogrammen von Travelan. White Label Reise Datenbanken für die eigene ... Partner-ID Passwort Geld verdienen mit Reisen Einführung Werbemittel Verdienst Referenzen Kontakt
travelan.ch Geld Verdienen Geld Verdienen Mit Reisen
69 Grüter Reisen Hochdorf Carfahrten

Reisen AirportService Vermietung und Carfahrten ... Erleben Sie eine Gute Fahrt ! zur Startseite Offertanfrage Kontakt Philosophie Reisen Airport
grueter-reisen.ch Carfahrten Car Bus Reisen
70 KontextReisen KontextReisen
6004
Luzern
KontextReisen sind überschaubare Gruppenreisen und führen in die Länder des Nahen Ostens. Sie erschliessen dabei ... Kontext-Reisen erschliessen geographische geschichtliche und kulturelle Kontexte zu den drei
kontext-reisen.ch KontextReisen Kontextreisen Kontext Reise
71 Reisen unsere Leidenschaft Reisen

Reisen Sie mit uns quer durch die USA. Ein Jahr lang sind wir mit dem ... Reisen unsere Leidenschaft Welcome Ueber uns Wochenende in New York Tag Tag Tag Tag USA
reiseleidenschaft.ch Reisen Reiselust USA Verreisen
72 Booknow.ch Günstige Reisen Reisen

Günstige Reisen mit Schweizer Qualtität Badeferien Lastminute Familienreisen ... Suche nach Hotelnamen Reise suchen ab CHF Sarina Bazzotti empfiehlt Malediven Sun Island Resort
booknow.ch Reisen Ferien Badeferien Lastminute
73 Kanada Reisen: Individuell travel worldwide AG Kanada
8001
Zürich
Wir machen Ihre Kanada Reise zum unvergesslichen Naturerlebnis! Rundreisen Motorhomes und Mietwagen clever kombiniert ... Zürich Kontaktformular » Kanada Reisen Entspannung pur in der Natur Wir machen Ihre Kanada
travelkanada.ch Kanada Reisen Kanada Ferien
74 Die Abreise AG :: Die Abreise AG Badi
8005
Zürich
Die Abreise :: weiter reisen weiter essen weiter bilden ... AG weiter reisen - weiter essen - weiter bilden Die Abreise AG · Alle Rechte vorbehalten · AGB
abreise.ch Badi Badeanstalt Freibad Seebad Flussbad Strandbad Oberrieden
75 Domino Reisen AG Aktiv

Alle Ferien und Reisen mit kompetenter Beratung Spezialreisen Rundreisen Pauschalreisen Individualreisen. ... Reisen und Buchen Themen-Übersicht - Pauschalreisen - Individualreisen - Schnäppchen
dominotravel.ch Aktiv Ferien Alles Inklusive Altstadt Reisen
76 Das Reiseatelier stellt Ihnen reisebüro

Ein Reiseatelier stellt Reisen vom Feinsten zusammen lassen Sie sich beraten ...  Das Reiseatelier stellt Ihnen sinnliche kreative individuelle Reisen zusammen reiseatelier
reiseatelier.ch Reisebüro Dienstleistungen Reisen Europa Afrika
77 Jobs fussball jobs

jobs fussball reisen formel 1 ... reisen formel und vieles mehr Hier entsteht unser neuer Internet-Auftritt für creatives leben. Besuche
creativleben.ch Jobs Fussball Reisen Formel 1
78 Fussball WM Reisen 2014 Reiselade Huttwil GmbH WM
4950
Huttwil
Reisen Sie mit uns nach Brasilien und erleben Sie die WM 2014 live. Reiseanbieter für ... Sitemap Kontakt WM Reisen Kosten und Preise Reisen zur WM Hotels und Unterkünfte Ausflüge
fussballwmbrasilien.ch WM 2014 Tickets WM Brasilien Reise Brasilien 2014
79 Was ist .reise? dotreise-registry GmbH
21227
Bendestorf
.reise die neue TopLevelDomain der Reisewirtschaft ... Über .reise Was ist .reise? Vision Vorteile von .reise Google wird .reise-Domains lieben Grusswort
dotreise.ch
80 SkiReisen Skiurlaub in SkiReisen

SkiReisen in die Schweiz sind ein unvergessliches Erlebnis das mit vielen Besonderheiten punkten kann. ... Ski-Reisen Ski-Reisen in die Schweiz - immer wieder beliebt Ski-Reisen Ski-Reisen dienen
ski-reisen.ch SkiReisen Skireisen Schweiz Skigebiete
81 Travelsmile.de Lastminute Reisen Lastminute

Hier finden Sie Reise Angebote mit Tiefstpreisgarantie! ... Städtereisen Hotels . Wellness Wellness Reisen . The s.mile Family Reiseführer . Info-Service Auswertiges-Amt
travelsmile.ch Lastminute Reiseangebote LastMinute Billigreise
82 Home | tourasia Die tourasia Roemer AG tourasia
8304
Wallisellen
tourasia Die persönliche Art des Reisens ... Deutsch Français Drucken Home Reiseziele Reise planen Wissenswertes Blog Über uns Kataloge
tourasia.ch Tourasia Asien Reisen Fernost
83 URLAUB IN BESTEN HÄNDEN Schauinsland-Reisen GmbH Schauinsland
47051
Duisburg
Lastminute Pauschal nur Hotel oder nur Flug Angebote von SchauinslandReisen ... Teneriffa Hotel Iberostar Anthelia Schauinsland-Reisen GmbH Startseite Service Sitemap Anfahrt
schauinsland-reisen.ch Schauinsland Reisen Urlaub Angebote Hotel Flug Pauschal Lastminute
84 Suter Reisen Würenlingen Suter
5303
Würenlingen
Dies ist die Offizielle Website von Harry Suter Reisen in Würenlingen ... News Reisen Transporte Fuhrpark Kleinbus Unternehmen Kontakt Gästebuch Bildergalerie Harry Suter
suter-reisen.ch Suter Reisen Ferien Car
85 HILDES REISE TRILUNA FILM AG HILDES
8005
Zürich
HILDES REISE das schwule Roadmovie. © zuendergrafics.ch Print und WebGrafik by Nicole Meier fuer ... trailer background people impressions market links DVD OUT NOW! HILDES REISE der ultimative
hildesreise.ch HILDES REISE Das Roadmovie Von Christof Vorster
86 Moischele Reisen | Israel Israel

Moischele Reisen | Israel Reisen | Weltweit Reisen | Holiday and Business Travel Specials ... Wehntalerstrasse CH- Dielsdorf infomoischele + +
moischele.ch Israel Reisen Israel Tours Flug Online
87 Neuseeland Reisen Rundreisen neuseeland
5200
Brugg
Reisen in Neuseeland hier finden Sie Tipps Fotos und Anbieter. Die schönsten Plätze ... Home Nordinsel Südinsel Infos Neuseeland Reisen Kia Ora - Willkommen in Neuseeland
neuseeland-reisen.ch Neuseeland Reisen Rundreise Ferien
88 Rüttimann Reisen AG rüttimann

Die Rüttimann Reisen AG ist Ihr professioneller Partner wenn Sie sich etwas mehr als ... bei. Wir sind Ihr professioneller Partner wenn Sie sich etwas mehr als nur fortbewegen möchten. Rüttimann Reisen AG Bachstrasse
ruettimann-reisen.ch Rüttimann Reisen Niederbüren Carreisen
89 FinlandiaReisen: Ihr Spezialist für finlandiareisen
8036
Zürich
FinlandiaReisen DAS Reisebüro für Reisen nach Skandinavien und Finnland. Besonderen Wert legen wir auf ... Durchsuchen Sie unsere Seiten powered by Finlandia-Reisen ? Birmensdorferstrasse ? CH- Zürich ? Tel
finlandia-reisen.ch Finlandiareisen Reisebüro Zürich Schweiz
90 Reise ABC Infos Paris

Reise ABC Infos und tolle Fotos für Städtereisen in Paris London Berlin ... Reise-ABC Destinationen Berlin Rom London Paris New York Mallorca Internes Hinweis AGB
reise-abc.ch Paris London Berlin Rom
91 Globus Reisen exklusive globus

4 und 5 Sterne Hotels für Ferien voller Annehmlichkeiten. Buchen Sie jetzt Flüge und Luxushotels ... Globus Reisen Soley Experience Perfect Days Cruises Service Blog FAQ Reiselounge Pluscard Kataloge
globusreisen.ch Globus Reisen Reisen Ferien Luxushotel
92 Paradies Reisen Paradies

lastminuten Flug Ticket Weltweit Pauschalreisen paradies reisen hotel
paradies-reisen.ch Paradies Reisen
93 Ihre persönliche LebensReise LebensReise
6312
Steinhausen
LebensReise Fussmassage Lebensberatung Anita Roth ... Auf Ihrer Reise durchs Leben dürfen oder müssen Sie sich oft für den einen oder anderen Weg entscheiden
lebens-reise.ch LebensReise Fussmassage Lebensberatung Anita Roth
94 Preisvergleichsportal von ReiseKategorien Reiseportal

Das Portal beinhaltet Preisvergleiche alle wichtigen ReiseKategorien u.a. Lastminute Hotels Flüge ... Das Portal beinhaltet Preisvergleiche aller wichtigen Reise-Kategorien u.a. Lastminute Hotels
top-billig-reisen.ch Reiseportal Portal Preisvergleiche Reise Kategorien Lastminute
95 Fredys Bus Reisen Fredy

Reiseunternehmen fährt Sie sicher ans Ziel. Buschauffeur Fredy Aeschimann mit seinem Setra Car. Modern ... Fredy`s Bus Reisen Schliffenenweg Würenlos Natel Musik
fredys-bus-reisen.ch Fredy Aeschimann Bus Reisen
96 Wirkungsvolle CD bei unerfülltem Kinderwunsch

Bei Kinderwunsch Entspannungs Reisen in mp3 erhöhen Sie Ihre Chancen um nicht mehr ungewollt ... Registrieren Mein Warenkorb Login Kinderwunsch Reisen Entspannende Gedankenreisen für Ihr Unterbewusstsein
kinderwunsch-reisen.ch Kinderwunsch Wirkungsvolle Entspannungs Reisen Audiodateien
97 RoMa Reisen Minibustaxi

Gruppenreisen ab 8 Personen bis 20 Personen. Individuell für Reisen Ausflüge Transfers oder ... und Skitourenfahrer. Meine Angebote beinhalten von mir organiesierte Reisen. Danke für Ihr Interesse
minibustaxiroma.ch Minibustaxi Minibus Vereinsreisen Familienanlaesse
98 Asien Reisen und Ferien travel worldwide AG Asien
8001
Zürich
Buchen Sie Asien Reisen und Ferien beim Schweizer Spezialisten travelasia.ch! Ausgesuchte Angebote für Hotels ? ... sowie Rundreisen auf Bali. > Bali Reisen travel worldwide AG Kirchgasse CH- Zürich Tel +
travelasia.ch Asien Asien Reisen Asien Rundreisen
99 Grämiger AG Reisen Busreisen

Das Reise Transportunternehmen Grämiger AG in Bütschwil besteht bereits seit über 30 Jahren. Was ... Grämiger AG Reisen Transporte Hofackerstrasse Bütschwil
graemiger.ch Busreisen Carreisen Ostschweiz Reisen
100 Kultur und Erlebnis Reisen Reise

Als Reiseleiter und Tourguide zeige ich Ihnen auf meinen Kultur und ErlebnisReisen die schönsten Sehenswürdigkeiten von Dresden ... Reisen statt Rasen Wenn Sie bei einer Reise Zeit haben möchten um auch versteckte Schätze
reise-erlebnis.ch Reise Reisen Städtereise Städtereisen
101 Minigolfplatz.ch sport reisen unterhaltung minigolfplatz.ch

minigolfplatz.ch sport reisen unterhaltung
minigolfplatz.ch Minigolfplatz.ch Sport Reisen Unterhaltung
102 Philippines.ch gastronomie länder reisen philippines.ch

philippines.ch gastronomie länder reisen
philippines.ch Philippines.ch Gastronomie Länder Reisen
103 Urlaub mit Schauinsland Schauinsland-Reisen GmbH Reisen
47051
Duisburg
Urlaub mit SchauinslandReisen Lastminute Pauschal nur Hotel oder Flug Angebote ... Schauinsland-Reisen GmbH Startseite Service Sitemap Anfahrt Datenschutz AGB Kontakt Mobile Version
bahia-hotels.ch Reisen Urlaub Schauinsland Angebote Hotel Flug Pauschal Lastminute
104 Notizen.ch Tipps Reisen Freizeit notizen
6343
Rotkreuz
notizen.ch Tipps zu Reisen Freizeit Leben Arbeit Moden ... Eigenwerbung notizen - - Kontakt notizen - Startseite Kontakt notizen - Reisen
notizen.ch Notizen Tipps Notiz Tipp
105 NEWFOODLAND KULINARISCHE REISEN:  Jürgens & Bjaoui GbR Kulinarikreisen
10437
Berlin
Newfoodland bringt Menschen mit Passion für gutes Essen erlebnisreiches Reisen und Kultur zu den ... START DARUM REISEN GENUSS KONTAKT Venedig Kulinarischer Segeltörn Wein aus der Lagune private
newfoodland.ch Kulinarikreisen Kulinarik Kulturreisen Kulinarische Reisen
106 Schmid Reisen ? Reisebüro reisebüro

Wilkommen bei Schmid Reisen in der Altstadt Wil. Langjährige Erfahrung individuelle Beratung und gemütliches ... Willkommen im Reisebüro Schmid Reisen Wer sich schon immer gewünscht hat die geheimnisvolle WÃ
schmidsreisen.ch Reisebüro Wil Reiseangebote Reisen
107 Reisebüro Sissach Traumferien Reisen

Sie finden im Reisebüro Sissach Traumferien und Reisen an die schönsten Plätze auf dieser Erde! ... wir Ihnen die Welt zu Füssen. Sie finden in unserem Reisebüro Traumferien und Reisen an die schönsten Plätze
reisebuero-sissach.ch Reisen Ferien Buchung Traumferien
108 Easy ReisenLast Minute ReisenLastminute lastminute

Familienreisen mit Easy Reisen Reiseangebote günstig und billigEasy ReisenLast Minute ReisenLastminute BadeferienFamilienreisenPauschalreisenBillig Günstig FerienSonderangebote ... Bestes Reisebüro Brauchen Sie Hilfe? infoeasy-reisen Easy Reisen AG Centro CH-
easy-reisen.ch Lastminute Ferien Lastminute Lastminute Reisen
109 SindbadReisen Spezialist für Ägypten
8902
Urdorf
SindbadReisen Spezialist für Ägypten und die Türkei ... Badeferien Südtürkei Bodrum Blaue Reise Istanbul Grand Bazar Istanbul Reisetipps Türkei
sindbad-reisen.ch Ägypten Nilkreuzfahrt Egypt Türkei
110 C und A auf Cathrin

unsere Reise seit 15. April 2007 ... C und A auf Reisen ...zusammen mit Miro Direkt zum Seiteninhalt Hauptmenü Homepage Schweiz Logbuch
cunda2007.ch Cathrin Andi Schaerer Schuster
111 EcuadorReise.ch | Ecuador Reisen ecuador

Ecuador Reise: Reisen und Rundreisen in Ecuador mit Alexandra und Benedikt Aregger An der ... ausreicht um alle Sorgen loszulassen? Dann reisen Sie mit uns nach Ecuador! Wir Alexandra und Benedikt
ecuador-reise.ch Ecuador Reisen Reise Ferien
112 Rewi reisen ihr rewi
9500
Wil
rewi reisen. Ihr kompetenter Generalist f?r Badeferienangebote LastMinute und Flugtickets! ... Wetzikon Wil rewi reisen - Ihr Partner rund um Ihre Ferien. Holen Sie sich Inspirationen f?r die sch?nste
rewi-reisen.ch Rewi Reisen Kuoni Ferien Buchung
113 Tanztermine und mehr... tanzen
8704
Herrliberg
tanztermine.ch Das Informationsportal für den Grossraum Zürich und verwandte Themen wie Reisen Bücher ... suchen Tanzclub suchen Tanzen und Reisen Tanzen und Reisen ReiseTipps ReiseTipps Reisegewinnspiel
tanztermine.ch Tanzen Veranstaltungen Tanzschulen Tanzpartner
114 Startseite HoHo unterwegs Sabrina

Sabrina und Markus reisen um die Welt Ferien Reiseberichte und Fotos von unterwegs ... Hier findet Ihr allerlei über die Reisen von Sabrina und Markus. Rund um die Welt und immer wieder neu
hoho-unterwegs.ch Sabrina Markus Ferien Reisen Travel Reisetagebuch Reisebericht
115 FHI Reisen Terracus GmbH reisen
41515
Grevenbroich
Preis vergleichen online buchen günstiger Reisen. Wir finden für Sie auf einen Blick ... Home Last Minute All inclusive Katalogreisen Familienurlaub Club Urlaub Single Reisen Hotels
fhireisen.ch Reisen Katalogreisen Reisekatalog Städtereisen Pauschalreisen Familienreisen Fam
116 Calami plus fördert das calami

Calami plus fördert das Wohlbefinden während der Reise. ... xgenügt! Fördert das Wohlbefinden während der Reise. Bei leichter bis starker Unruhe
calami.ch Calami Wohlbefinden Reise Unruhe Unwohlsein
117 Willkommen bei Eggenberg Reisen Reisen

Willkommen bei Eggenberg Reisen ... Reisebüro Eggenberg AG Promenade CH- Gstaad Telefon Webdesign by cre
eggenberg.ch Reisen Eggenberg Luxus Einfach
118 Start Travelpoint Reisen Urlaub

Last Minute und mehr Pauschalreisen Nurflug Hotel Wellnesshotel und Mietwagen ... Facebook REISEN ZU TOLLEN PREISEN Travel Point AG. Dieser Name steht seit fast Jahren fu?r neutrale
travelpoint.ch Urlaub Reise Lastminute Pauschalreise
119 Signer Reisen namibia
8303
Bassersdorf
Erleben Sie mit uns das Abenteuer die Wildnis und das Ursprüngliche. Wir organisieren 4x4 ... Wer sind wir Links AGB Kontakt Home Reise-Angebote News Galerie Gästebuch Shop
signer-reisen.ch Namibia Botswana 4x4 Signer
120 :: Willkommen bei DänemarkReisen Reisen

Unsere Diensleistungen umfassen Dänemark Reisen nach Mass. Wir bieten Ihnen umfassende Unterstützung bei der Planung ... by Dänemark-Reisen Oberwil Switzerland Fon + +
daenemarkreisen.ch Reisen Urlaub Dänemark Dänemark
121 Hauri Reisen AG: Willkommen haurireisen

haurireisen
hauri-reisen.ch Haurireisen Kreuzfahrten Flussfahrten Zofingen Reisen Gruppenreisen Flüge Südaf
122 USA Reisen: Kompetent und travel worldwide AG USA
8001
Zürich
Wir machen Ihre USA Reise zum wahren Traumurlaub! Rundreisen Mietwagen und atemberaubende Nationalparks ... Zürich Kontaktformular » USA Reisen vom Spezialisten Gut beraten durch die Staaten
travelamerica.ch USA Reisen Amerika Ferien USA Urlaub
123 Home Ak Travel Flüge

aktravel.ch ? günstige Reisen günstige Hotels und Flüge +++ Superbillig fliegen; Urlaub buchen ... Home Günstiger fliegen Nur Flug Günstiger reisen Gesundheitsreisen Städtereisen Kulturreisen
aktravel.ch Flüge Reisen Pauschalreisen Last Minute
124 Individuelle Kanada Reise mit Kanada
29549
Bad Bevensen
Buchen Sie Ihre KanadaReise direkt beim KanadaSpezialReiseveranstalter. Einfach online mit kompetenter Beratung und professionellem Service. ... Kanada Reisen Wohnmobil-Reisen Wohnmobil-Preisvergleich Alle Vermieter Modelle
transcanada.ch Kanada Reise Buchen Reiseveranstalter
125 Tharin Patrizia Reisebüro Tharin

Reisebüro Letaba Letaba Travel Letaba Reisen ... elementare Bestandteile der Erde. Und so empfinden wir auch das Reisen Ein wichtiger Teil des Lebens
letaba.ch Tharin Patrizia Wetzikon Reisen Letaba
126 Urlaub Last minute Reisen Urlaub

Urlaub Reisen Last Minute: Günstige Reisen in schöne Hotels garantieren einen unvergesslichen Urlaub. ... Prag Rügen Zell am See Skireisen Wellnessreisen Aktivreisen Sie sind hier Urlaub Reisen Last Minute
holidaytrex.ch Urlaub Last Minute Reisen Pauschalreisen Kurzurlaub Busfahrt Hotel
127 Medicus Reisen Medicus Reisen AG medicus
8048
Zürich
Medicus Reisen vermittelt medizinische Behandlungen im Ausland auf Wunsch in Verbindung mit einem Urlaubsaufenthalt. ... Reisen Türkei Antalya Kemer Ungarn Budapest - Die Perle an der Donau Kroatien
medicusreisen.ch Medicus Reisen Medizine Medizinische Ausland
128 Home Epicro kroatienreisen
6020
Emmenbrücke
Ihr OnlineReisebüro für Kroatienreisen Veloferien Autorouten Rundreisen Schnorcheln und weitere Angebote ... schon ab . CHF pro Person {tab=-Tages-Reise} Eigene Anr Weiterlesen Motorsegler Charter
epicro.ch Kroatienreisen Reisen Nach Kroatien Veloferien
129 Reisebüro webook.ch für ihre Online

Ihr Reisebüro webook.ch mit Reisen und Ferien weltweit kostenloser Beratung und persönlicher Service. Jetzt ... Reisebüro webook Home Reisen Städtereisen Rundreisen Kreuzfahrten Individualreisen
reisebuero-webook.ch Online Reisebüro Webook.ch Familienreise Familienurlaub
130 Individuelle Ferien Exklusivreisen ErlebnisReisen

Erlebnisreisen von ACAPA ausgewogene Reisen und Ferien in besten Hotels nach Ihren Wünschen ... )acapach www.reisen-ist-erleben Video Portrait Familien Reisen Das gemeinsame Abenteuer zählt
reisen-ist-erleben.ch ErlebnisReisen Indien Iran Madagaskar
131 Island ProTravel Ihr Island

Vielfältige Angebote für Ihren Urlaub in Island! Island Reisen mit dem Reiseveranstalter für Gruppenreisen ... für alle die individuell reisen wollen. Grönland Erleben Die größte Insel der Welt lädt dazu ein Tradition und Kultur
islandwohnmobile.ch Island Urlaub Reise Island Reisen Reiseveranstalter Island Protravel
132 Ihr Partner für Urlaub Hotel

Ihr Partner für Ferien und Reisen Urlaub in der Schweiz Hotels für Wellness Golf Sport ... News und jetzt ab in die Ferien! Ihr Partner für Urlaub Ferien und Reisen. Search Hotels Schweiz
bg-web.ch Hotel Ferien Urlaub Reisen
133 Reisebüro webook.ch für ihre Online

Ihr Reisebüro webook.ch mit Reisen und Ferien weltweit kostenloser Beratung und persönlicher Service. Jetzt ... Reisebüro webook Home Reisen Städtereisen Rundreisen Kreuzfahrten Individualreisen
xn--reisebro-webook-4vb.ch Online Reisebüro Webook.ch Familienreise Familienurlaub
134 KopfReisen Carreisen | Reisecar KopfReisen
8484
Weisslingen
Mit Kopf Reisen sicher und bequem die schönsten Carreisen erleben. ... Über uns Offertanfrage So finden Sie uns Links Unsere Reisen Mehrtagesreisen Tagesreisen Weihnachtsmärkte Ferien
kopf-reisen.ch KopfReisen Carfahrt Winterthur Busfahrt Carfahrten
135 Für die schönen Tage lazi
8630
Rüti
Wenn Sie eine Dienstreise oder Ferien in der Schweiz planen kontaktieren Sie Lazi Reisen. ... Preise Kontakt Für Reisebüros Hotels LAZI REISEN Walderstrasse CH- Rüti T +
lazi-reisen.ch Lazi Reisen Reise Eisen Schweiz
136 Faszination Reisen Faszination

Faszination Reisen informiert über Tourismus Reisen und Kulinarik. ... Kulinarik Kontakt Faszination Reisen Erlebnisse - Erholung - Genuss Wir haben das Original. http
tourpress.ch
137 Himalaya Reisen Ihrem himalaya

Himalaya Reisen Ihrem ganz speziellen Reisebüro für Kultur Reisen spirituelle Erlebnisse sowie Trekkingtouren ... Reisen Alpenstrasse A CH- Wettingen - Mobile - E-mail gautam
himalayareisen.ch Himalaya Reisen Reisebüro In Der Schweiz
138 Aktivferien und Bürobedarf aktivferien

Zwinglis Reisen organisiert begleitete Veloferien Wanderferien und Rundreisen inkl. Reise Verpflegung Unterkunft ... REISEN Veloreisen Wanderungen Ausflüge Aktivferien PAPETERIE Shop Büroartikel Bücherladen
zwinglis.ch Aktivferien Carreisen Wanderferien Veloferien
139 SindbadReisen Spezialist für Ägypten
8902
Urdorf
SindbadReisen Spezialist für Reisen nach Ägypten ... Diaserie Aegypten Internet-Seiten von Sindbad-Reisen Einzel-Versicherung Jahresversicherung ETI-Schutzbrief
xn--gypten-rundreisen-pqb.ch Ägypten Egypt Kairo Luxor
140 Travelhouse Reisen MTCH AG travelhouse
8152
Glattbrugg
Entdecken Sie die riesige Angebotsvielfalt Ihres Ferienspezialisten für individuelle Reisen: Hotels und Rundreisen online buchen. ... Finden Sie Ihre Reise Länder Themen Reisearten Weitere Suchkriterien Gründe für Vancouver
travelhouse.ch Travelhouse Reisen Hotel Rundreise
141 Semptec Schweiz Outdoor Semptec

Semptec bietet Ihnen alles rund um Outdoor Heizstrahler Trekking Reise Camping ... Heim-Elektronik Heizstrahler Outdoor Survival Reise Camping Outdoor Trekking Schuh-Spikes
semptec.ch Semptec Outdoor Heizstrahler Trekking
142 Kidstravel.ch Reisen mit Reisen

Der Reisespezialist für Reisen mit Kindern und Familienreisen. Ausgesuchte Angebote speziell für Familien oder Alleinreisende mit ... über eine Reise wert Milde Winter mit blühenden Rosen zu Weihnachten die Mandelblüte im Februar
kidstravel.ch Reisen Mit Kindern Kinderreisen Familienreisen
143 SindbadReisen Spezialist für Ägypten
8902
Urdorf
SindbadReisen Spezialist für Reisen nach Ägypten ... Fotogalerien Erlebnisberichte/Impressionen Reisetipps Ausflugstipps Unsere Internet-Seiten Sindbad-Reisen
xn--gypten-reisen-9eb.ch Ägypten Egypt Kairo Luxor
144 Autobus.ag..liestal Öffentlicher Verkehr Öffentlicher
4410
Liestal - Lageplan
Öffentlicher Verkehr Reisen Dienstleistungen
aagl.ch Öffentlicher Verkehr Reisen Dienstleistungen
145 Anikas Reisen AG Abschlussreisen

AnikasReisen Ihr persönlicher Spezialist für Zypern Griechenland und Destinationen weltweit... ... Abschlussreisen Jubi-Reisen Badeferien Städtereisen Sprachreisen Mietautos Willkommen bei Anikas-Reisen
anikas-reisen.ch Abschlussreisen Abschlussklassen Gruppenreisen Partyferien
146 Mühlebach Reisen Aktuelles Carreisen
8501
Frauenfeld
Herzliche Willkommen bei Mühlebach Reisen. Wir bieten Ferienreisen Transferfahrten Hochzeitsausflüge Wellnessaufenthalte und ... Aktuell Winterzauber - Winterspass im Europa Park .. Reise suchen Herzlich willkommen
xn--mhlebachreisen-gsb.ch Carreisen Mühlebach Muhlebach Muehlebach
147 Thailand Reisen via Dubai Thailand

Thailand Reisen via Dubai Burma Rundreise. Das einzigartige Reiseerlebnis. Privat geleitete Rundreise in Kleingruppe. ... Liebe Reisefans Meine Begeisterung für Thailand und Dubai ist gross. Auf jeder Reise geniesse
asiareisen.ch Thailand Reisen Dubai Myanmar Burma
148 Berichte Fotos und reisen

Reiseberichte Fotos und viele Eindrücke und Hintergrundinfromationen über die schönsten Orte auf unserem Planeten ... Reisen und Leben im Ausland. Auf unserem Reise-Blog swissnomads bloggen wir über unsere
sunandstar.ch Reisen Bericht Abenteuer Tauchen
149 Himalpin : Reisen im Himalaya
4132
Muttenz
Seit über 10 Jahren veranstalten wir Reisen im nordwestindischen Himalaya. Auf unserer Seite finden ... Willkommen auf der Webseite von Himalpin Seit über Jahren veranstalten wir Reisen im indischen Himalaya
himalpin.ch Himalaya Reisen Trekking Jeep
150 Reisebüro für Skandinavien: Norwegen Glur Reisen AG Skandinavien
4009
Basel
Das Schweizer Reisebüro Glur Reisen ist seit über 30 Jahren auf SkandinavienReisen spezialisiert. Buchen Sie ... attraktive Skandinavien-Kreuzfahrten im Angebot. GLUR Reisen AG Spalenring CH- Basel + (
glur.ch Skandinavien Reisen In Den Norden Nordlandreisen
151 Mongolei Reisen Im Dschingis

Mongolei Reisen. Unsere Rundreisen in die Mongolei lässt Sie einige der letzten unberührten Gebiete der ... -Ir- Karibik Reisen Aktuell sind Gäste und keine Mitglieder online Mongolei Reisen
mongoleitravel.ch Dschingis Khan Mongolei Reisen Mongolei
152 Anikas Reisen AG Abschlussreisen

AnikasReisen Ihr persönlicher Spezialist für Zypern Griechenland und Destinationen weltweit... ... Ferienwohnungen/-Häuser Partyferien Abschlussreisen Jubi-Reisen Badeferien Städtereisen Sprachreisen Mietautos
anikas.ch Abschlussreisen Abschlussklassen Gruppenreisen Partyferien
153 Home Muslime

Muslime reisen ... Samstag . Dezember Home Jerusalem reisen Home Designed by Deluxe IT
muslimereisen.ch Muslime Reisen
154 REISEREPORT.CH Die ReiseCommunity AMC:MüLLER GmbH Reisebericht
5620
Bremgarten AG
Reisereport.ch ist die modernste Plattform im Internet für den Austausch von Informationen und Tips rund ... Reise-Community der Schweiz. Hier tauschen Sie Reisefreudige über Erfahrungen aus präsentieren
reisereport.ch Reisebericht Reisen Schreiben Texte
155 Sam Reisen saobracajna Srbija

Zelite bezbedno i udobno da putujete ? Rezervisite vase mesto na vreme !!! Sam Reisen ... SAM REISEN saobracajna firma    Svajcarska-Srbija Pocetna Aranzmani Linijski saobracaj Galerija
samreisen.ch Srbija Svajcerska Autobus Autobus Prevoz Lasta Lasta Reisen
156 Kleibenzett'lReisen und Transporte GmbH Kleibenzettl

WirbewegenMenschen ist eine Domain der Kleibenzett'lReisen und Transporte GmbH. Ob Carreise Firmenausflug Vereinsausflug ... Wir-bewegen-menschen ist eine Domain der Firma Kleibenzett'l-Reisen und Transporte GmbH
wir-bewegen-menschen.ch Kleibenzettl Kleibenzett'l Kleibenzett'lReisen Wir Bewegen Menschen Carreisen Gu
157 USA Tour USA NASCAR

NASCAR Reise 2014 nach Daytona. Coke Zero 400. USA Tour Drag Racing Willkommen ... Beaches Ice cold Beer's Great Steaks USA Reise NASCAR Reise Im Mietwagen von Chicago nach Miami
usaracing.ch NASCAR Reise 2014 Coke Zero Daytona.
158 Reisen nach Afrika Marokko

Der Spezialist für Individual Reisen nach Afrika. Marokko Reisen SüdafrikaReisen. Namibia Ferien Mali ... Reisen nach Marokko Ein faszinierendes Land mit magischem Ambiente orientalischem Charme
cultoura.ch Marokko In Marokko Marrakech
159 Ferien in Thailand: Reisen Thailand

Ihr ThailandSpezialist in der Schweiz für Flüge und Hotels. Reisen Sie durch ein Land voller ... der Papiere im Flugzeug. Kostenlose Auskunft - Ferien in Thailand - Reisen in ein Land
thailand.ch Thailand Thailand Reisen Thailand Flug
160 :: Anspruchsvoll reisen mit  wishlinereisen.de | Urlaub wishline

Hochwertige Reisen von ausgewählten Reiseveranstaltern: Abenteuerreisen Aktivurlaub Erlebnisreisen Expeditionen Gourmetreisen ... Urlaub Ferien Reisen - Reiseangebote für Reiseziele weltweit! Die Website ist aktuell in Ã
wishline-reisen.ch Wishline Wishline Reisen Wishlinereisen Reisen Reise Urlaub Ferien
161 Paris24.ch die ParisReiseSeite Paris

ParisReisenInfos finden Sie auf Paris24.ch: Ob ParisFlüge ParisHotels oder ParisZugfahrten ... Paris.ch Chambres d'hôtes Eiffelturm Fluß Seine Heiraten in Paris Triumphbogen Weblinks Paris
paris24.ch Paris ParisReisen Paris Triumphbogen Paris
162 Island Reisen | Urlaub Island

Alles über Island Reisen ? Ihr Island Urlaub vom Spezialisten für Gruppenreisen Rundreisen ... Flug - schon ab ? . - pro Person - Jetzt buchen! Unsere Island Reisen Studien und Gruppenreisen
norwayprofishing.ch Island Urlaub Reise Island Reisen Reiseveranstalter Island Protravel
163 Marrakech.ch immobilien info länder marrakech.ch

marrakech.ch immobilien info länder reisen
marrakech.ch Marrakech.ch Immobilien Info Länder Reisen
164 Lastminute Urlaub Last last

Travel24.ch ist ihr Partner für Last Minute Reisen. Last Minute Urlaub günstig buchen mit einer ... für Last Minute Reisen - Last Minute Urlaub buchen - travel.ch Last Minute Reisen travel.ch
travel24.ch Last Minute Reisen Last Minute Last
165 Hawaii Reise Reisen Kanada

Rundreisen in Hawaii auf den Pazifikinseln westlich der USA Informationen für Ihre Hawaii Reise ... Was empfiehlt der Spezialist für meine Hawaii Reise ? Bilder dieser Region finden Sie in unserem Fotoalbum
hawaii-reise.ch Kanada Canada USA America
166 Seychellen Reisen Ferien travel worldwide AG Seychellen
8001
Zürich
Seychellen Reisen und Ferien vom Spezialisten! Günstige Angebote für Ihren Traum Urlaub. Hotels ? Honeymoon ... Zürich Kontaktformular » Seychellen Reisen. Hotels Tauchen Honeymoon Seychellen Reisen
travelseychelles.ch Seychellen Reisen. Seychellen Ferien. Seychellen Urlaub. Hotels Auf
167 Asien Reisen Thailand ID Reisewelt GmbH Asien
06886
Lutherstadt Wittenberg
Asiamar by ID Reisewelt Individuell mit den besten Airlines Reisen nach Thailand Vietnam ... bei Flugzeugunglück+++ Auf www.id-reisewelt finden Sie Reisen Angebote und Urlaub nach Thailand
idreisewelt.ch Asien Reisen Günstige Asien Reisen Flüge
168 Transsib.ch:  Alles für individuelle transsib
6020
Emmenbrücke
Ausführliche Informationen über die Transsibirische Eisenbahn und Reisen in Russland der Mongolei China ... sich besser auf eine Reise mit der Transsibirischen Eisenbahn der BAM oder weiteren Verkehrsmitteln
trans-sib.ch Transsib Transsib Transsibirische Eisenbahn
169 Sonnenbrillen Reise Brille Sonnenbrillen

zu reisen fahren im Freien und andere Augenschutz versoixmatchrace.ch Läden mit ... ?. Sie sparen % ! www.versoixmatchrace .Alle Rechte vorbehalten. Sonnenbrillen Reise
versoixmatchrace.ch Sonnenbrillen Reise Gläser Gläser Geschäfte
170 Travelstar auf Reise! Wenn

Travelstar auf Reise! Wenn nicht jetzt wann dann? ... Ich liebe es zu reisen. Das bereisen von neuen unbekannten Ländern das Entdecken einer neuen
travelerstar.ch Wenn Nicht Jetzt Wann Dann?
171 Argovia Classics Miete Oldtimer
5200
Brugg AG
Mit dem Oldtimer die Schweiz erkunden: Ausflüge Reisen und Touren individuell genussvoll reisen ... Oldtimer Reisen Spezialangebote Preise Wir über uns Andere über uns Links Kontakt und Formulare
argovia-classics.ch Oldtimer Oldtimer Miete Oldtimer Cabrio
172 RHFILM Reise Erinnerungen aus ferienvideo.ch

www.ferienvideo.ch www.ferienvideo.de Reise Erinnerungen aus der Sicht des Touristen ... Ausführliche DVD-Filme über klassische Reisen Rundreisen Die DOK-Filme zeigen nur Gebiete
ferienvideo.ch Ferienvideo.ch Videofilme.ch Gast Ferien
173 Reise/Kulturvideos/DVD's/lebendige Reiseinfos von Promofilm Reisen

Reise und Kulturvideos DVD's CDROM's über Regionen in Asien Informationsvideos Corporate ... CCADBFBFEAFAAB PROMOFILM Reise- und Kultur-Dokumentationen auf DVD's Angkor
promofilm.ch Reisen Reiseinfos Asien Travelvideos DVD's Tibet Angkor SilkRoad
174 Kuoni Reisen AG Kuoni

KuoniReisen Entdecken Sie die verschiedenen Reiseveranstalter der Kuoni Reisen Gruppe.
kuoni-reisen.ch Kuoni Reisen Helvetic Tours Reisen Netto
175 Vaglio Reisen: Willkommen Vaglio

Vaglio Reisen AG Interlaken
vaglio-reisen.ch Vaglio Maurice Reisen Ferien
176 Laros Reisen Ihr Kreta
4147
Aesch
Laros Reisen Ihr GriechenlandSpezialist in der Schweiz. Lassen Sie sich von uns verführen... verführen ... Home Informationen Griechenland Zypern Weltweit Aktuelles LAROS Reisen
laros.ch Kreta Urlaub Kreta Reisen Kreta Ferien
177 Media Reisen Ihr Media Touristik AG Reisen
4051
Basel
Wir organisieren Flüge Badeferien Pauschalreisen Gruppenreisen Individualreisen und mehr. Mit Media ... Willkommen bei Media Reisen - Ihr Spezialist für Reisen weltweit Ob Lastminute Badeferien Flüge
mediareisen.ch Reisen Reisebüro Ferien Urlaub
178 Koch Reisen AG Giswil Koch

Koch Reisen AG 6074 Giswil
koch-reisen.ch Koch Reisen AG 6074 Giswil Obwalden
179 Dom Rep Karibik Dom
66119
Sarrbrücken - Deutschland
Dom Rep Karibik Reise Spezialisten für die Dominikanische Republik Pauschalreisen Last Minute ... Dom-Rep-Reise Ihr DomRep Karibik Reisespezialist für DomRep Reisen - Pauschalreisen - Last
dom-rep-reise.ch Dom Rep Reise DomRep Reisen Dom Rep Reisen
180 Neuengland Reise Reisen Neuengland

Rundreisen in den Neuengland Staaten im Nordosten der USA Informationen für Ihre Neuengland Reise ... am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Neuengland Reise ? Bilder dieser Region
neuengland-reisen.ch Neuengland New England Neuengland Reise
181 NORDLICHT.CH Reisen in urlaub

Nordlichter Reisen in Norwegen Polarlichtfotos Fjordnorwegen Reiseberichte Norwegen Alesund Geiranger ... Rekordjahr! Höchste Sonnenaktivität seit Jahren Willkommen bei nordlicht! REISEN IN NORWEGEN Im Jahre
nordlicht.ch Urlaub Norwegen Ferienhaus 2011 Reisen
182 Home Carreisen Moser

Einsteigen geniessen erleben mit Moser Reisen. Carreisen Badeferien Musikreisen Städtefahrten ... DE en Reisesuche Reise Suchen Buchen Bitte geben Sie ihre Wunschangaben ein. alle Kategorien
moserreisen.ch Moser Carreisen Moserreisen Moser Reisen
183 M+K Reisen Seit reisen
4053
Basel
Die M+K Gruppe in Basel (CH) | Tour Operator für Bus Flug Schiffs ... Startseite Ihr Reiseunternehmen M+K Reise-Club Fotogalerien Links Kontakt AGB Grüezi Willkommen
mktravel.ch Reisen Busreisen Schiffsreisen Flugreisen
184 Online Reisebüro Webook.ch für Reiseb??ro

Buchen Sie Jetzt mit mit dem Online Reiseb??ro webook.ch ihre Ferien Reisen Flüge ... Webook Last Minute Angebote Home Reisen Rundreise Kreuzfahrten Individualreisen Familienferien
we-book.ch Reiseb??ro Lasteminute Webook.chWinterthur Z??rich
185 Nordwest USA Reise Kanada

Rundreisen in den Staaten im Nordwesten der USA Informationen für Ihre NordwestUSA Reise ... der Spezialist für meine Nordwest USA Reise ? Bilder dieser Region finden Sie in unserem Fotoalbum - Nordwest USA
nordwestusa-reisen.ch Kanada Canada USA America
186 Shamrockreisen.ch ihre schweizer irland

wir haben uns zum ziel gesetzt individuelle wünsche aber auch massgeschneiderte irland reisen ihrem ... unterkunft kontakt unsere angebote shamrock-reisen wir wissen wovon wir sprechen Shamrock-Reisen
shamrock-reisen.ch Irland Irland Reise Irland Reisen
187 Reisen Tschechische Republik Reisen

Reisen Tschechische Republik Reisen Slowakei Implus Reiseatelier. Wenns um Reisen Tschechische Republik oder ... Prag Tschechien Slowakei - von Ihrem Spezialisten. Münstergasse . CH- Zürich Telefon +
implus-reiseat.ch Reisen Tschechische Republik Reisen Slowakei Ferien Tschechien Geschftsreisen
188 Last Minute Reisen rreisen

Last Minute Reisen Sonderangebote und Flüge im Preisvergleich alle Lastminute Angebote mit CHReisegarantie. ... im Preisvergleich alle Lastminute Angebote mit CH-Reisegarantie. Home ... last minute reisen ... Start ... Inhalt
lastminhit.ch Rreisen Travel Last Minute Preisvergleich Sonderangebote Last Minute
189 SEND James ohne SEND JAMES ist ein Premium-Dienst der KEP AG Koffer
50825
Köln
Reisen Sie zu den schönsten Plätzen in Deutschland Österreich Schweiz Südtirol ... Stets zu Diensten Ihr Reise Gepäck- und Koffer-Service Kontakt Gepäck Zielort Abholung Rückreise
sendjames.ch Koffer Versenden Gepäck Versenden Gepäck Verschicken
190 ARABICA OrientReisen Iran ARABICA

ARABICA OrientReisen: Reisen individuell und in Kleingruppen von Nordafrika bis zum Mittleren Osten. Iran ... Web-Design Whirlweaver Über ARABICA Programm Reise- und Vertragsbedingungen Unterlagen
arabica-orientreisen.ch ARABICA ARABICA OrientReisen ARABICA Orientreisen
191 Northwest Territories Reise Kanada

Rundreisen in den Northwest Territories im Norden von Kanada Informationen für Ihre Northwest Territories ... und Tundra des Nordens. Die typischen Lodges der Region sind gute Ausgangspunkte für eine Reise sie bieten
northwestterritories-reisen.ch Kanada Canada Tours Travel
192 Ost Kanada Reise Kanada

Rundreisen in den Provinzen im Osten von Kanada Informationen für Ihre OstKanada Reise ... ? Thema Empfehlung Was empfiehlt der Spezialist für meine Ost Kanada Reise ? Bilder dieser Region finden
ostkanada-reisen.ch Kanada Canada USA America
193 Kuoni Reisen: Ferien und Kuoni Reisen AG Traumferien
8010
Zürich
Traumferien mit Kuoni Reisen in fernen Ländern und Europa. Badeferien Städtereisen Rundreisen ... Sie mit uns die Reise Ihres Lebens! Mehr erfahren Luxuriös sparen Exklusive Reisen ? verblüffend günstig. Mehr erfahren
kuoni.ch Traumferien Kuoni Reisen Ferne Länder
194 Home Carreisen Moser

Einsteigen geniessen erleben mit Moser Reisen. Carreisen Badeferien Musikreisen Städtefahrten ... DE en Reisesuche Reise Suchen Buchen Bitte geben Sie ihre Wunschangaben ein. alle Kategorien
moser-reisen.ch Moser Carreisen Moserreisen Moser Reisen
195 Last Minute und Reise lami24.de

lami24.de das neue Reiseportal für Ihren Last Minute Urlaub mit vielen Reise ... Kreta ab - Euro Alle Lastminute Reise Angebote Last Minute nur Flugangebote Hin- und Rückflug ab Rom
lami24.ch Lami24.de Lastminute Last Minute Pauschalreisen
196 Naturus GmbH naturus GmbH Naturkundliche
6247
Schötz
Naturkundliche Reisen ... Startseite Sitemap Kontakt naturus GmbH Naturkundliche Reisen Faunistik naturus GmbH
naturus.ch Naturkundliche Reisen Naturus Wiprächtiger
197 NordSkandinavien und Nordkap Reise Norwegen

Rundreisen in den skandinavischen Regionen im Norden von Europa Informationen für Ihre Nordnorwegen Nordkapp ... Das Nordkap ist ein Höhepunkt auf einer eindrücklichen Reise durch den skandinavischen Norden. Die Landschaft
nordkapp-reise.ch Norwegen Schweden Finnland NordSkandinavien
198 Zumstein CarReisen Chur Zumstein Car-Reisen AG Reisen
7000
Chur
Mit der ganzen Erfahrung von über 30 Jahren im Reiseverkehr ist ZUMSTEINReisen der ideale Partner ... Portrait Kontakt Gruppenreisen Vorschau Aktuelles Standort News Galerie Zumstein Car-Reisen AG
zumstein-reisen.ch Reisen Carreisen Ferienreisen Vereinsreisen
199 Honeymoon Ferien Malediven Legends Travel GmbH Honeymoon
8032
Zürich
Honeymoon Ferien Malediven Südafrika Rundreise Sri Lanka Reisen bei Legends Travel ... Seychelles- Luxusurlaub im Paradies! Honeymoon - Traumhafte Flitterwochen! Die Flitterwochen sind eine Reise
legendstravel.ch Honeymoon Ferien Malediven Südafrika Rundreise
200 Heinz und Tsiyon Büchler Reise
8162
Steinmaur
Reisen auf der ganzen Welt ... Über uns Fahrzeuge Tagebücher alt Tagebuch aktuell Reise Infos Reisebücher Tierbilder Unterwasser
heinz-buechler.ch Reise Afrika
201 Neuseeland.org.nz reisen Neuseeland

NZvillage die deutsche Neuseeland community. Reiseratgeber mit Forum Reisemarkt über 200 Fotos ... . Das Photo-Album. Newsletter Der Qualitäts-Newsletter fuer NZ. Reisen Die aktuellen Reiseangebote -anbieter
neuseeland-newzealand.ch Neuseeland Neuseeland Nz NZ
202 Reise als Mietwagentour Abenteuerreisen Reise

fidibustours Ihr Reisepartner leiter und veranstalter für Mietwagenreisen mit Allrad für alle ... fidibusteam Abenteuerreisen Voyages aventure Adventure Tours Follow-me Kontakt Budget WILLKOMMEN Reise
patagonien-atacama-mietsharingtouren.ch Reise Reiseveranstalter Reiseleiter Mietwagentour
203 Zurkirchen Reisen Startseite Zurkirchen Reisen GmbH tagesfahrten
6102
Malters
Zurkirchen Reisen GmbH Reisen in der ersten Reihe ... Offertanfrage Online-Katalog Zurkirchen Reisen GmbH Industriestrasse CH- Malters Telefon +
zurkirchen-reisen.ch Tagesfahrten Rundreisen Erlebnisfahrten Saisonfahrten
204 Québec Reise Reisen Quebec

Rundreisen in der Provinz Québec im Osten von Kanada Kanada Osten Informationen für ... Sie in unserem Fotoalbum - Québec Und Vorschläge für Ihre Reise in unseren Reiserouten - Québec Der Medien
quebec-reisen.ch Quebec Provinz Quebec Québec Provinz
205 MAWI REISEN AG : Reisebüro

Mawi Reisen AG: Reisebüro Bischofszell Frauenfeld : Abenteuerreisen Kreuzfahrten Automiete Busreisen ... Start Reiseangebote Traumreise-Generator Flug Hotel Auto Vergangene Reisen MAWI
mawi.ch Reisebüro Reisebüro Frauenfeld Reisebüro Bischofszell
206 Ferien Reisen ferien

Ferien und Reisen online buchen das online Travel Reisebüro für Last minute Ferien
ferien-und-reisen.ch Ferien Reisen Ferien Buchen Last
207 Segelreisen Segelurlaub Kaya Lodge Touristik GmbH segelreisen
33104
D-Paderborn
Segelreisen online buchen: Segelurlaub Mitsegeln auf Segeltörns Kojencharter Blaue Reise auf Mallorca ... Mallorca Mitsegeln Segelschule Türkei Blaue Reise Alle Ziele Griechenland Kroatien Türkei Hausbootreisen
segelreisen-online.ch Segelreisen Segelurlaub Kojencharter Mitsegeln
208 Sardinien Ferien Hotels Sardinien

Ferien und Hotels in Sardinien Sizilien Elba Apulien und Toskana. Ihr Ferien ... Marmi Lido di Camaiore Lucca Punta Ala San Gimignano Siena Unsere Ferien Reise Destinationen Sardinien
smeraldotours.ch Sardinien Sizilien Elba Apulien
209 Ctravel.ch Contemporary Travel travel

Contemporary Travel ist Ihr professioneller Partner für zeitgemässes Reisen. Auf www.ctravel.ch finden Sie spannende ... Familienhotels Business Reisen Ferienhäuser-wohnungen Safari Sprachferien Expeditionen Trekking Mietwagen
ctravel.ch Travel Ctravel.ch Last Minute Contemporary
210 Staub Reisen Menzingen staub

StaubReisen Menzingen: Reiseunternehmen für Autoreisen und Kleinbusvermietung.
staubreisen.ch Staub Reisen Staubreisen Reisen Busreisen
211 SALM AG Startseite SALM AG KleinBusReisen
5106
Veltheim
Reisen wie auf Wolken ... Â Â Startseite Virtuelle Ausstellung Rückruf-Service Kontakt Reisen Ausflüge Reisen
comfortbus.ch KleinBusReisen
212 Galapagos Luxuskreuzfahrten Exklusive Galapagos

Exklusive Kreuzfahrten und Reisen auf den Galapagos Inseln in Ecuador. Luxuskreuzfahrten Luxusjachten Luxushotels ... Galapagos Inseln Reisen Hochwertige Kreuzfahrten Yachten auf den Galapagos Inseln by
galapagos-kreuzfahrten.ch Galapagos Luxuskreuzfahrten Galapagos Kreuzfahrten Luxuskreuzfahrten
213 Reisebüro Höfe March Kanton reisebüro

Reisebüro Hertig Reisen AG: Wir informieren Sie ausführlich und kompetent über alle Destinationen! ... Weltreise  brainstormers Hertig Reisen AG      Churerstrasse       Pfäffikon Â
hertigreisen.ch Reisebüro Hertig Reisen Mauritius Seychellen
214 Willkommen bei Denner Reisen Denner
8152
Glattbrugg
Denner Reisen. Qualitätsreisen zu Discountpreisen. Denner Reisen orientiert sich am Denner Discount Prinzip: bewährte Denner ... Sparen Newsletter Über uns Denner Reisen Willkommen bei Denner Reisen Bungalows Vista Flor ab CHF
denner-reisen.ch Denner Reisen Voyages Denner Ferien
215 Island Reisen Spezialist für Island

Vielfältige Island Reisen Angebote für Ferien in Island Islandreisen mit dem Spezialveranstalter für ... von schönen Rundreisen in Island mit dem Mietwagen für alle die individuell reisen wollen. Grönland erleben
islandprotravel.ch Island Urlaub Reise Island Reisen Reykjavik Reiseangebote Individual
216 Indo Orient Tours GmbH Tajikistan

Willkommen beim Reisebuero Indo Orient / Indoculture. Ihr Partner fuer die schoenste Zeit des Jahres. ... Anspruchsvoll Reisen mit Indo Orient Tours heisst INDO ORIENT TOURS GmbH Weinbergstrasse
indoculture.ch Tajikistan Tadschikistan Massgeschneiderte Reisen Nach Tajikistan Tailor Made
217 Formel 1 Reisen | F1

Reisespezialist für Formel 1 Reisen und Formel 1 Karten und Formel 1 Tickets ... Formel Reisen Formel Karten Formel Tickets - Tripi Travel Tickets Die Site wird geladen
schaerlines.ch F1 Tickets Online Shop Formel1Reisen Pole Position Paddock
218 Home SIGMG Reisen SIG&MG Reisen GmbH SIG
8105
Regensdorf
SIGMG Reisen Hac ve Umre organizasyonlar? tatil mekanlar? ve uygun fiyata uçak biletleri ... IST BEGRENZT BEEILT EUCH MIT DER ANMELDUNG. Mit SIGMG Reisen und MILLI GÖRÜS jährige Erfahrung
hac-umrah.ch SIG SIGMG SIGMG Reisen Reisen
219 Lidl Reisen ...einfach Lidl E-Commerce International GmbH & Co. KG Lidl
74172
Neckarsulm
...einfach urlaubiger! ... um alle Funktionen unserer Seite nutzen zu können. Zur Navigation springen Zum Inhalt springen Reisen Lidl lidl
lidl-reisen.ch Lidl Reisen
220 Island Reisen Grönland NORDWIND REISEN GmbH Grönland
87700
Memmingen
Urlaubsreisen nach Grönland Island und Spitzbergen ... Ihr Urlaubsspezialist für Island Grönland und Spitzbergen Reisen NORDWIND Beratungshotline +
nordwindreisen.ch Grönland Reisen Island Reisen Island Urlaub
221 Home SIGMG Reisen SIG

SIGMG Reisen Hac ve Umre organizasyonlar? tatil mekanlar? ve uygun fiyata uçak biletleri ... KAYITLARIMIZ BA?LAMI?TIR. SIGMG Reisen ve M?LL? GÖRÜ? birlikteli?iyle y?ll?k tecrübe... Kontenjan?m?z
sig-mg.ch SIG SIGMG SIGMG Reisen Reisen
222 Berlin24.ch Reisen auch Berlin

Ihre nächsten Ferien in der deutschen Metropole Berlin? Hier finden Sie Infos zu BerlinFlügen ... Berlin.ch Berlin meistbesucht Berlin-Fotos Berlin-Flüge Zimmer in Berlin Reise Schweiz - Berlin
berlin24.ch Berlin BerlinFerien BerlinUrlaub BerlinFlüge
223 Reisen nach Ukraine

Reisen nach Ukraine www.ukrainereisen.ch ... Willkommen in der Ukraine Reisen nach Ukraine Reiseprogramm Unsere Reisedaten Städtereise
ukraine-reisen.ch
224 PolarAdventures | Kreuzfahrten und kreuzfahrt

Seit 1996 organisiert PolarAdventures Kreuzfahrten und Flüge in die Arktis und Antaktis. Die aktuellen Angebote ... Expeditionen Kreuzfahrten und See-Reisen mit Eisbrechern Polarschiffen und Seglern in die Arktis
polaradventures.ch Kreuzfahrt Antarktis Polar Spitzbergen
225 Reisebüro eurotour ferien ferien

reisebüro eurotour ferien reisen flüge hotels mietwagen weltweit ... Reisebüro EuroTour CH - Basel + + Flugreisen weltweit
eurotour.ch Ferien Reisen Lastminute Reisebüro
226 SOLAMENTO Reisen GmbH Reisen

Solamento Reisen GmbH Vertrieb von Reisen aller Art. Wir führen alle namhaften Reiseveranstalter in
solamento.ch Reisen Reisevertrieb Kurzurlaub Kurzfrist
227 Ferien mit Jet Reisen reisebüro

Einzigartige Ferien Flug und Hotel und PauschalAngebote warten auf Sie. Buchen Sie Ihre ... Jet Reisen AG Bruchstrasse Luzern Tel Home Flüge > Nur Flug
jetreisen.ch Reisebüro Luzern Ferien Reisen
228 MaxReisener.ch Krafttraining max
21337
Lüneburg
Hier informiert Max Reisener (MaxPhilipp Reisener) über sein Hobby Krafttraining ... Reisener ist Krafttraining ein großes Hobby immerhin sollte jeder einiges dafür tun um seinen Körper fit
max-reisener.ch Max Reisener Philipp Reisener Maxphilipp Reisener Reisener
229 Ferien Kenia Ferien Ferien

Ferien Kenia Ferien Seychellen Hotels Mauritius kanarische inseln Last Minute Reisen
globo-tours.ch Ferien Kenia Ferien Seychellen Hotels Mauritius
230 Clickundflieg.ch Last Minute Lastminute

Günstige Last Minute Reisen und Reiseangebote bequem online buchen mit Preisgarantie von click und ... ) -- Zürich Vorderer Orient -- Abu Dhabi -- Bahrain -- Dubai -- Katar -- Maskat (Oman
clickundflieg.ch Lastminute Reisen Pauschalreisen Urlaub
231 TravelplanLast Minute ReisenLastminute BadeferienFamilienreisenPauschalreisenBillig lastminute

Familienreisen mit travelplan Reiseangebote günstig und billigtravelplanLast Minute ReisenLastminute BadeferienFamilienreisenPauschalreisenBillig Günstig FerienSonderangebote ... Easy-Reisen - Wir planen Ihre Reise und machen Ihre Ferien so zur schönsten Zeit des Jahres. Sie finden
travelplan.ch Lastminute Ferien Lastminute Lastminute Reisen
232 Hotel reiseführer hotel

hotel reiseführer suchmaschine reise GastroWelt ob cafe restaurant gaststaette oder bar ... Ihr Hotel- und Gastroführer Ihr Hotel Reiseführer oder Suchmaschine für Ihre nächste Reise
hotels-europa.ch Hotel Reiseführer Suchmaschine Reise
233 MAWI REISEN AG : online

Mawi Reisen AG: Reisebüro Bischofszell Frauenfeld : Abenteuerreisen Kreuzfahrten Automiete Busreisen ... Start Reiseangebote Traumreise-Generator Flug Hotel Auto Vergangene Reisen MAWI
mawi-reisen.ch Online Buchen Last Minute Flug Buchen
234 Spitex in den Ferien Krankenpflege
5363
Weggis
Reisebegleitung Unterstützung auf Reisen Pflegedienst weltweit Spitexleistungen auch in den Ferien. privat ... Reise-Spitex Startseite Leistungen Aktuelles Reisen Tagesausflüge Feste feiern Kontakt Shop
viva-la-vita.ch Krankenpflege Spitex Arzt Krankenschwester
235 Alaska Yukon Reise Kanada

Rundreisen im Norden der USA und von Kanada Informationen für Ihre Alaska Yukon Reise ... heutigen Zeit für viele verloren gegangen ist. Eine Reise in diese Region ist aber auch immer eine Reise
alaskayukon-reisen.ch Kanada Canada USA America
236 Rundreisen USA Reisen usa
5200
Brugg
USA Reisen hier finden Sie Tipps Routen Fotos und Anbieter für Rundreisen.
rundreisen-usa.ch Usa Reisen Rundreisen Ferien
237 Manta Reisen Ihr Manta
8010
Zuerich
Manta Reisen Ihr Spezialist für den Indischen Ozean und Tauchferien. Mit dem Reiseplaner einfach ... Rundreisen Manta Reisen - Ihr Spezialist Manta Reisenerfüllt Ihre Ferienträume! Die schönsten Strände
manta.ch Manta Reisen Malediven Ägypten Rotes
238 Visentireisen visenti

visentireisen / Sie haben es sich verdient / Exklusive Events – Nur für Sie
visenti.ch Visenti Zeit Zum Leben Unternehmen Für
239 Altin Travel Bern | ALTIN
4566
Kriegstetten SO
Altin Travel Bern | Ihr Spezialist für TürkeiReisen | Hotel Last Minute Angebote ... mit einem neuen Erscheinungsbild online. Es ist uns eine Freude Sie bald mit unzähligen Reise-Angeboten
altintravel.ch ALTIN ALTIN TRAVEL Bern Altin
240 Last Minute reisen zu Reisen

Reisen Online Reisebüro
jambolinux.ch Reisen Travel Reisebüro Last Minute
241 Carfahrten Gruppenreisen von CarReisen

Carfahrten Gruppenreisen von Bissig Reisen Schwyz CarFahrten Gruppenreisen Carreisen mit dem ... Reiseziele Pilgerziele durchgeführte Reisen Gutscheine FAQ allg. Informationen Links offene Stellen Bissig
bissigreisen.ch CarReisen CarFahrten Carfahrten Carreisen
242 Smiley Reisen GmbH Cars

Smiley Reisen GmbH macht Reisen mit Cars im In und Ausland sowie Schulbustransporte und Rollstuhltaxi. ... Smiley - Reisen GmbH Startseite Monatsangebote Kleinbusvermietung Reisecars und Busse Catering
smiley-reisen.ch Cars Reisebusse Reisecar Reisebus
243 OUTDOORLAND Reise Freizeit Outdoor

Outdoorland ihr Spezialist für Reise Freizeit und Trekkingausrüstungen ... Thermarest Tubbs MSR GoalZero Leki Pieps Julbo Reisen Reisebekleidung Trekking Trekkingausrüstung
outdoorland.ch Outdoor Outdoorbekleidung Outdoorschuhe Wanderschuhe
244 Pocetna ALfa Reisen ALFA

ALFA Reisen Kombi Prevoz Putnika i Robe Tel + Viber CH: 075 413 43 13 SRB: 069
alfa-reisen.ch ALFA Reisen Kombi Prevoz Putnika I Robe
245 Rocky Mountains Reise Kanada

Rundreisen in den Staaten und Provinzen im Westen der USA und in Kanada Informationen ... am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Bilder dieser Region finden
rockymountains-reisen.ch Kanada Canada USA America
246 PhilomenaReisen ihre Reise Philomena Reisen AG Reisen
8965
Berikon
Badeferien Rundreisen Kreuzfahrten Abenteuerurlaub Skiurlaub Geschäftsreisen Polarreisen Sprachaufenthalte ... Philomena Reisen AG Bahnhofstrasse CH- Berikon ÜBER UNS SPRACHREISEN KONTAKT
philomena-reisen.ch Reisen Ferien Städtereisen Badeferien
247 Index Home index

reiseservice ... Fredy Loosli ? Postfach ? CH- Triengen ? ? ? info
reise-service.ch Index Reiseservice ReiseService Reiseservice
248 Wüstentouren von SindbadReisen in Wüstentouren
8902
Urdorf
SindbadReisen. Spezialist für Wüstentouren in Aegypten ... Kameltrekking quer durch den Sinai Ägypten !! Fahrt in die Westliche Wüste Reise durch die Westliche Wüste
wuestentour.ch Wüstentouren Wüste Kamel Jeep
249 FamilienReisen Reisen mit familienreisen
4912
Aarwangen
Sie suchen Ferien für Ihrer Familie mit Babies Kleinkindern oder Kindern? Egal ob ein ... Schinznach-Dorf ACAPA Reisen Homeoffice Aarwangen Turnhallestrasse CH- Aarwangen E
familien-reisen.ch Familienreisen Familienreisen Reisen Familien
250 Ihr Reisebuero fuer Reisen Reisebüro

Reisebüro für Reisen nach Slowenien | Hotels Flüge Billigflüge Gruppenreisen | Hotel ... Reisen nach Slowenien Programme Reisen in der Gruppe auf Anfrage Hotels online buchen Online Hotelbuchung
slowenien.ch Reisebüro Slowenien Last Minute Reisen Hotel
251 Clickundflieg.com Last Minute Lastminute

Günstige Last Minute Reisen und Reiseangebote bequem online buchen mit Preisgarantie von click und ... Top Beratung Sicher buchen Hotelbewertungen Reisebüro Click und Flieg Unsere Reise-Experten beraten
click-lastminute.ch Lastminute Reisen Pauschalreisen Urlaub
252 Ecuador Reisen Galapagos Seefeld-Reisen Gmbh
8008
Zürich
Unsere Spezialität sind Reisen nach Ecuador Galapagos. Wir schneidern für Sie individuelle Reisen nach ... Klima Wissenswertes WEITERE ZIELE Peru Mythos Amazonien Venezuela Reise Feedback Ecuador ab
handmade-travel.ch
253 Individuelle Reisen nach Mass Design Travel AG Luxusreisen
6205
Eich
Individuelle Reisen weltweit exakt nach Ihren Vorstellungen. Kompetente Reiseberatung für Ihre individuelle Traumreise ... Südsee Tanzania Thailand Reise des Monats Beratung Design Travel AG - Spezialist für Individualreisen
design-travel.ch Luxusreisen Individuell Geplante Reisen Golfreisen
254 Cafe restaurant gaststaette bar cafe

GastroWelt ob cafe restaurant gaststaette oder bar bei 100000 Einträgen werden Sie fündig! Planen ... Reise Reservierung für Urlaub Übernachtung Lastminute Suchen oder Online buchen Deutschland Schweiz
gastro-welt.ch Cafe Restaurant Gaststaette Bar
255 Irland.guru Ihr Irlandspezialist Donegal

irland.guru Ihr Irlandspezialist vor Ort für individuelle massgeschneiderte Irland Reisen. Entdecken Sie Irland
wildatlanticway.ch Donegal Ferien Irland Mietwagen Rundreisen
256 Kathrin Severin | Kunst

Kathrin Severin Kunst Kurse und Reisen ... Navigation überspringen Kathrin Severin Kunst Seminare und Reisen
kathrinseverin.ch
257 Badeferien Urlaub Reisen Ferien AIRTAXI WINGS AG Flug
8307
Effretikon
Badeferien Urlaub Reisen Ferien Flug Flüge online buchen ... Badeferien Brunei Lastminute Badeferien Bucher Reisen Lastminute Badeferien Bulgarien Lastminute Badeferien
airtaxi-wings.ch Flug Buchen Flugreservierung Online
258 Willkommen auf der Startseite senn

senn senne reise ... senne mehr erleben... Startseite Reiseberichte Aktuell USA-Reise Archiv Nordkap-Tour Archiv Bali
senne.ch Senn Senne Reise
259 Home Reise

Meine Reise Erlebnisse und Ansichten ... Michu auf Reisen Main Menu Home Über mich Kontakt Meine Reisen Fotos Gästebuch Wanderung Meinungen
michaelhorst.ch Reise Ansichten. Michu Horst
260 Easy holidaysLast Minute ReisenLastminute Ferien

Familienreisen mit easyholidays Reiseangebote günstig und billig easyholidaysLast Minute ReisenLastminute BadeferienFamilienreisenPauschalreisenBillig Günstig FerienSonderangebote ... .- Dubai > .- Malediven > .- Karibik > .- easy-holidays powered by Easy-Reisen
easy-holidays.ch Ferien ägypten Last Minute Türkei Last
261 Reisen Reisebüro Reisen

CH Reisebüro für Russland Osteuropa und Asien für Individual und Gruppenreisen. Wir organisieren ihre ... möchten wir den Schwerpunkt nicht auf Profit sondern auf die Zufriedenheit jener setzen die Reisen
rusvisit.ch Reisen Reisebüro Russland Ukraine
262 USAReisen Südwesten Reisen Touren USA

USA reisen USA Südwesten Reisen USA Reiseplanung Tour Grand Canyon ... Planen Sie eine Reise in den USA? Dann sind Sie bei uns genau richtig! Wir haben die USA
bannwarts-usa.ch USA Südwesten Reisen Reiseplanung
263 LastsecondReisen: Günstig günstiger

Sie haben Ferien und sind spontan genug für eine LastsecondReise? Wohin egal Hauptsache günstig? ... Last Second Reisen Spontan in die Ferien reisen! ? Reisen ? Ferien ? Urlaub ? Städtereisen
lastsecond-reisen.ch
264 Lastminute Urlaub | Super lastminute

Lastminute Urlaub Mit dem Restplatzshop haben Sie sich für den Spezialisten zum Thema Reisen
restplatz-shop.ch Lastminute Urlaub Super Last Minute Reisen
265 Buholzer Reisen c/o Buholzer Fischer Weine AG travel2
6370
Stans
Wir bieten ein seriöses OnlineReiseportal auf hohem Niveau. Ihre Traumferien finden Sie bestimmt bei uns. ... Kontakt Kontakt travel travel Startseite Startseite Pauschalreisen/Reisen Pauschalreisen/Reisen Einfach
buholzer-reisen.ch Travel2 Reisen Buholzer Traumkreuzfahrten Clubschiff
266 Motorrad Adventure Reisen Motorrad

Motorrad Adventure Reisen organisiert und führt Motorradreisen in der Schweiz sowie in Europa durch.
moto-adventure-reisen.ch Motorrad Adventure Reisen Motorrad
267 BICI Adventure Mountainbike by BICI AktivFerien GmbH abenteurreisen
6314
Unterägeri
Wir sind ein Anbieter von Abenteuerreisen im Himalaya. Wir sind spezialisiert auf Bikeferien Wanderferien ... Home Tripfinder + Kontakt News Singletrail-Reisen Ladakh Nomadic Trails ( T
mountainbikeguide.ch Abenteurreisen Mountainbike Reisen Mountainbike Reisen Himalaya
268 Home Natural Reisen natural

Natural Reisen Biel AG Spezialist für Familienferien Geschäftsreisen Gruppenreisen Kreuzfahrten Sonderangebote ... Sie uns! Gründe die für uns sprechen Geschäftsreise-Angebote Gruppenreisen Ob begleitete Reise
natural-travel.ch Natural Ag Sa Naturaltravel Naturaltravel Switzerland Biel Bienne
269 Bösch Reisen Busfahrten Bamp;ouml;sch

Bösch Busreisen Reisen mit besonderem Flair Gruppenreisen für Halbtages und Tagesfahrten Wochenausflügen ... Bösch Reisen GesmbH Co KG A- Lustenau Hagstraße + -
boeschreisen.ch Bamp;ouml;sch Bamp;ouml;schreisen Busreisen Reiseveranstalter
270 Reiselade Huttwil Ihr Reiselade Huttwil GmbH Reiseerfahrung
4950
Huttwil
Ihr Reisespezialist in Huttwil. Profitieren Sie von unserer Reiseerfahrung Dein Reisepartner für Ferien und ... SITEMAP KONTAKT Länderinformationen Reisen weltweit Sport Aktivreisen Sprachreisen » Globo Study
reiselade.ch Reiseerfahrung Rundreisen Reiselade Huttwil GmbH Hochzeitsreisen Individuelle
271 Herzlich Willkommen Nicolettas
9056
Gais
ReiseFotos und ReiseErzählungen aus aller Welt. Menschen Landschaften Momentaufnahmen. Mit Kartenshop für Ihre ... Die Wiedervereinigung Meine Reisen Azerbaijan Unsere Highlights Reise-Erlebnisse Reise-Erlebnisse Reise-Erlebnisse
nicolettas-welt.ch
272 Altstadt Reisen AG

Verwöhnen Sie sich mit einer Reise bei Altstadt Reisen. Golfreisen Kreuzfahrten Formel1Reisen und ... und in der Luft Billigflüge Golfreisen Formel Reisen Kreuzfahrten AIDA Cruises Hapag Lloyd Princess Cruises
altstadt-reisen.ch
273 Chamäleon Die Reise

Reisen mit höchstens 12 Teilnehmern – Afrika Amerika Asien Ozeanien ... Unsere Art des Reisens Unsere Geschichte Veranstaltungen Reisesicherheit Fotowettbewerb Jobs Chamäleon
chamaeleonreisen.ch
274 Bavetia Reise und Jagdbüro Jagdreisen
8606
Greifensee
Jagdreisen Jagdreise JagdReisen Bavetia bavetia hunting hunter Jagd ... Datenschutz Nützliche Links Bavetia ? Reise- und Jagdbüro ? CH- Greifensee ? Albertus-Walder
bavetia.ch Jagdreisen Jagdreise JagdReisen Bavetia
275 Babas Travel Page Baba

Homepage von Babas Reisen ... UND WILLKOMME UF MINERE TRAVELPAGE! Wie ihr ja wüsset lieb ich s`reise über alles und gnüss es sehr immer
babastravels.ch Baba Reisen Travel Ferien
276 Buholzer Reisen travel2

Wir bieten ein seriöses OnlineReiseportal auf hohem Niveau. Ihre Traumferien finden Sie bestimmt bei uns. ... Sie eine unverbindliche Offerte! verena.buholzeracapa Fusszeile Reisen Buholzer Webdesign by Worldsoft AG
reisen-buholzer.ch Travel2 Reisen Buholzer Traumkreuzfahrten Clubschiff
277 Reisesuche Urlaub webseiten

gefunden bei REISESUCHE.CH HOME ... Individualreisen Kinder/Jugendliche Pauschalreisen Plus Reise-Planung/-Büro Sprach-/Studienreisen Auto/Fähre/Flug
reisesuche.ch Webseiten Reisen Urlaub Tourismus
278 Netztourist reisen durchs

reisen durchs internet und um die welt ... Netztourist reisen durchs internet und um die welt Menu Skip to content Home Über Netztourist R
netztourist.ch
279 Reiseberatung Reisen zu g?nstig

Reisen zu fairen Preisen Wir bieten Ihnen eine unabh?ngige Reiseberatungs und Informationsplattform. Hier k?nnen Sie sich ... Home Flugreisen Reiseinformationen Hotel Reiseberatung USA Canada Sportreisen Reisen zu fairen
eagle-travel.ch G?nstig Ferien USA Fliegen Business
280 Chamäleon – Die Reise

Reisen mit höchstens 12 Teilnehmern – Afrika Amerika Asien Ozeanien ... Unsere Art des Reisens Unsere Geschichte Veranstaltungen Reisesicherheit Fotowettbewerb Jobs Chamäleon
chamaeleon-reisen.ch
281 Sibirien Reisen und Sibirien

Sibirien Reisen und Trekking ganz anders Beat Rufibach Bergführer
sibirientrekking.ch Sibirien Reisen Trekking Russland Mongolei Abenteuer Rufibach Bergsteigen
282 Ostasien Zentralasien Tourismus asien

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Ostasien und ... Anime Comicfiguren Reise durch Japan. Unterwegs im Reich der Niedlichkeit. "Kawaii" heißt
ostasien-zentralasien.ch Asien Westasien Ostasien Zentralasien Südasien Südostasien Volksrepublik China
283 Ozeanien Tourismus Reisen ozeanien

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Ozeanien ... mit dem Outback Eine Reise in die Zeit der australischen Eisenbahnpioniere. Eine -stündige Zugfahrt
ozeanien-oceania.ch Ozeanien Australien Neuseeland Südpazifik Pazifik Frühling Sommer Herbst
284 Nordosteuropa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Nordosteuropa ... Steigs. Eine Reise durch die landschaftlich wie kulturell überaus reizvolle Region. Ein Artikel
nordost-europa.ch Europa Nordeuropa Skandinavien Finnland Nordosteuropa Mitteleuropa Russland Ural
285 ALTAY REISEN Türkei Ferien Türkei
8050
Zürich
Altay Reisen Ihr Türkei Ferien Spezialist Last Minute Golf Wellness Hotels in ... !!! Top Hotels - All Rights Reserved by Altay Reisen AG Screenesign Xartist Developer
altayreisen.ch Türkei Ferien Last Minute Lastminute Hotels Antalya
286 Zepato Exklusive Reisen B Commerce GmbH Reise
8044
Zürich
Exklusive Reisen. Einzigartige Ferien. Unvergesslichen Urlaub in erstklassigen Hotels günstig online buchen.
zepato.ch Reise Ferien Urlaub Hotel
287 Südeuropa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Südeuropa ... im Reise-Blog von Viator Travel Bearbeitet von DestinationenCH Datum .. Tags Italien
sued-europa.ch Europa Westeuropa Südeuropa Südosteuropa Alpenländer Alpen Spanien Portugal
288 Unsere Reisen Anasazi

... Unsere Reisen USA - Frankreich Deutschland Sommer Spanien Kontakt
damona.ch Anasazi Damona USA Südwesten
289 ARGENTINAENVIVO Argentinien argentinien

Argentinaenvivo Organisation von Reisen nach Argentinien. Sommer Winter wie auch Skiprogramme. Exzellente Kombination ... welche sich jedermann auf einer Reise in ein neu zu entdeckendes Land als ständigen Begleiter an seiner Seite wünscht
argentinaenvivo.ch Argentinien Argentina En Vivo Reisen Reise Rundreise Viajes
290 Reiseversichern.ch  Informationen zum Thema reiseversichern.

reiseversichern.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-versichern Weitere Links Diese Webseite wurde vom Domain Inhaber dynamisch generiert
reise-versichern.ch
291 Reisewettbewerb.ch  Informationen zum Thema reisewettbewerb.

reisewettbewerb.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-wettbewerb Weitere Links Diese Webseite wurde vom Domain Inhaber dynamisch generiert
reise-wettbewerb.ch
292 MotoGP Reise Carreise Carreise

MotoGP Reisen 2015. Carfahrt Carreise MotoGP Assen Holland 2015 mit Pinky
pinky.ch Carreise Busreise Carreisen MotoGP Reisen
293 Gross Reisen Rorschach · Gross Reisen GmbH Rorschach
9400
Rorschach
Gross Reisen Rorschach · Ihr Partner für grossartige Carreisen ... Gross Reisen Reiseangebot Fahrzeugflotte Mietfahrzeuge Allgemeines Kontakt Firmenchronik Team Gross
grossreisen.ch Rorschach Bodensee St.Gallen Carreisen Veloreisen Rundreisen Spezialreisen Tages
294 Willkommen in Carlos Welt Camping

Wohnmobil Reisen Freizeitspass im auf und am Wasser ... . Unsere erste grosse Reise mit dem Träumli. Durch Deutschland bis Travemünde dann mit der Fähre
fellca.ch Camping Reisen Ribbs
295 Ostafrika Zentralafrika Tourismus afrika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Ostafrika und ... Afrikas können Urlauber viel erleben - besonders dann wenn sie ihre Reise selbst zusammenstellen
ostafrika-zentralafrika.ch Afrika Africa Afrique Ostafrika Zentralafrika Regenwald Regenwälder Steppen
296 Fanevents :: Reise Sportreisen

Fanevents ist ein junges Unternehmen das vorwiegend im Bereich von Sportreisen aktiv ist. ... Kontakt Home Über uns Unsere Angebote Unsere Partner Buchung Reservation Reisen Kontakt
fanevents.ch Sportreisen Tickets Hotel Reise
297 Paraway.ch Gleitschirm

Seite über Gleitschirmfliegen Reisen und Selbstausbau eines Campers ... News Gleitschirm Reisen Selbstausbau Wohnmobil Links Ueber uns Gästebuch
paraway.ch Gleitschirm Gleitschirmfliegen Reise Reisen
298 Südamerika Tourismus Reisen lateinamerika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Südamerika ... selbstzufrieden bequem in seiner wahrnehmbaren traditionellen Identität. Einblicke im Reise-Blog von Viator
suedamerika-southamerica.ch Lateinamerika Latin Latein Spanisch Südamerika South America Mittelamerika
299 Finland Fantasy GmbH: Finnland Reisen Finnland

Finland Fantasy GmbH: Finnland Reisen günstige Schiffsreisen Hütten Lappland Luxusschiff Reise Reiseanbieter
nordic-design.ch Finnland Reisen Günstige Schiffsreisen Hütten Lappland
300 Nordeuropa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Nordeuropa ... des «ewigen» Eises Streifzug durch Grönland. Reisen in Grönland auf der Insel mit dem «ewigen» Eis
nord-europa.ch Europa Nordeuropa Skandinavien Grossbritannien Britische Inseln Nordosteuropa We
301 Europa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Europa ... Nordatlantik Kreuzfahrt nach Spitzbergen - Abenteuerliche Reise um die Inselgruppe im Eismeer. Publiziert
europa-europe.ch Europa Nordeuropa Skandinavien Grossbritannien Britische Inseln Nordosteuropa We
302 Schmid Reisen AG gruppenreisen

Ihr zuverlässiger Partner für anspruchsvolle Projekte aus der Reise und Eventveranstaltung ... Home Sitemap Schmid Reisebüro AG Seminarstrasse CH- Wettingen Schweiz
schmidreisen.ch Gruppenreisen Studienreisen Incentivereisen Leserreisen Kunstreisen Kulturreisen
303 Nordafrika Nordostafrika Tourismus afrika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Nordafrika und ... von Gibraltar Tipps für die Reise nach Marokko Der perfekte Tag in Tanger. Zwischen Europa
nordafrika-nordostafrika.ch Afrika Africa Afrique Nordafrika Nordostafrika Westafrika Zentralafrika Wüsten
304 Westasien Arabien Tourismus asien

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Westasien und ... will am Reise-Boom des Nachbarn Dubai teilhaben - mit einem eigenen Tourismuskonzept Anstatt auf Gigantomanie
westasien-arabien.ch Asien Westasien Arabien Arabische Halbinsel Ostasien Zentralasien Armenien
305 RICO REISEN THUN
3600
Thun
Die schönsten Ferien bucht man im Reisebüro Rico Reisen GmbH in Thun. ... Im Burgzentrum Burgstrasse CH- Thun Telefon + Tele + rico-reisen
rico-reisen.ch
306 Milya.ch ? Fotografie

Fotografie Mode Reisen alles was ein Mädel braucht ... Milya Startseite Mode News Fotografie Reisen Datenschutzerklärung Kontakt Popular Tags
milya.ch
307 Südpazifik Tourismus Reisen ozeanien

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen im Südpazifik ... Destinationen in Papua New Guinea. Es gibt mehr als nur einen Grund für eine Reise in diese Region aber fast
suedpazifik.ch Ozeanien Australien Neuseeland Südpazifik Pazifik Amerikanischsamoa Cookinseln N
308 Alpenländer Europa Tourismus europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in den Alpen ... von Spiegel Online mehr auf www.spiegel/... Eine kleine Schweizer-Reise Autor Hour
alpenlaender.ch Europa Westeuropa Alpenländer Alpenlaender Alpen Gebirge Berge Schweiz
309 Feinster Basmati Reis ? rezepte

Napura steht für hochwertige ausgewählte Produkte rund um Reis. Bequem Einkaufen im WebShop und ... informiert bleiben? Abonnieren Sie unseren Newsletter ? Aktuell Bilder rund um das Thema Reis in unserem
napura.ch Rezepte Liebhaber Reformhaus Weihnachten
310 ReiseNetzwerk 4trips.de

Das ReiseNetzwerk 4trips.de bietet Infos zu weltweiten Destinationen und speziellen Reisearten; ReiseInspirator und Bildergalerien machen ... nach Göteborg Es gibt kaum eine schönere Art zu Reisen um die unverwechselbare Landschaft des Nordens
4trips.ch
311 USA Amerika Tourismus nordamerika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in den USA ... VereinigteStaatenVonAmerika Ein Insider Guide für den Mardi Gras in New Orleans. Einblicke im Reise-Blog von Viator
usamerika.ch Nordamerika Northamerica Kanada Usa Usa Kanada Kanada Canada
312 KAYAK ? Günstige Flüge Kayak Europe GmbH Billigflieger
8001
Zürich
Finden und buchen Sie günstige Flüge Hotels Ferien und Mietwagen mit KAYAK. Die ... > {{?}} Explore Wohin für wie viel? Jetzt testen Vergleichen Sie Hunderte Reise-Anbieter. Finden
kayak.ch Billigflieger Billigflüge Billigflug Billige Flüge
313 Westafrika Zentralafrika Tourismus afrika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Westafrika und ... Kamerun Westafrika Kolonialgeschichte Kolonialzeit Missionare Kamerun Bei einer Reise
westafrika-zentralafrika.ch Afrika Africa Afrique Westafrika Ostafrika Zentralafrika Wüsten Halbwüsten
314 Reise nach Marokko mit marokko

Marokko Tours ist eine Gesellschaft zum Transport von Touristen mit Sitz in Marrakech. Sie organisiert ... Sie herzlich willkommen bei Noble Tour einer spezialisierten Reise- und Transportagentur die auf eine lange
marokko-reisen.ch Marokko Reisen TouristenTransport Maroko Marrakech
315 Cruise + ReiseMarktplatz Reisen
6005
Luzern
Kreuzfahrten und ReiseAngebote der Spezialisten OnlineProspekten vergleichen Prospekte und Offerte verlangen Telefonberatung oder persönlicher ... + Gesundheit Wellness Gesundheit Premium + Luxus Home Reise-Services + Tipps Kontakt Katalogbestellung Offerte
reise-marktplatz.ch Reisen Kreuzfahrten Schiffsreisen Flussfahrten Rundreisen Erlebnisreisen Studien
316 Home Rene

Reise um die Welt. ... Über uns Reisen Hiking GPS-Links Links User Login Spitsbergen - The Movie Gallery Update Gerade sitze
farfromhome.ch Rene Livia Reisen Around The
317 Gran Canaria Reisen gran

Gran Canaria Reisen Urlaub Gran Canaria Bungalows Apartments direkt am Meer
gc-reisen.ch Gran Canaria Reisen Urlaub Gran Canaria Bungalows
318 DAS SCHWEIZER REISEPORTAL reisen

www.reisen.ch Das Portal zum Reisemarkt Schweiz. Tausende Reiseangebote Last Minute Angebote
reisen.ch Reisen Ferien Travel Ferien Reisen Urlaub Lastminute Last
319 Malta Gozo Reise malta

Malta Gozo online Reisen UrlaubsPortal. Infos günstige Buchung von Hotels in Malta ... HOME Multimedia Bildagentur Forum Videos Reisen Ausflüge Touren Ferienwohnungen Ferienhäuser
imalta.ch Malta Gozo Reisen Urlaub
320 Ann Amann Travel Consulting Reisen
8703
Erlenbach
Es gibt nicht die „perfekte Reise“ für alle aber es gibt die perfekte Reise ... Incentive Reisen Kontakt Wir organisieren Ihre perfekte Reise - abgestimmt auf Ihr limbisches Profil
annamann.ch Reisen Limbik Limbisches Profil Reiseberatung
321 Tanzania Safari | Reisen Tanzania

Twende Tanzania Ihr persönlicher Reiseplaner. Seit über zehn Jahren zeige ich Einzelpersonen Paaren ... der Welt. Gerade eine Safari Reise in die Serengeti ist ein absolutes Must-Do für alle Freunde
twende-tanzania.ch Tanzania Safari Safari Reise Tansania Reise
322 Home reist reisen Diese

... Umzüge Reisen Umzüge Reisen Reise-Event . Januar reist reisen gmbh ? Bahnhofstrasse ? CH
reist-reisen.ch Diese Seite Gibt Informationen über Das Team Von
323 Engel auf Reisen Engel

Wenn Engel auf Weltreise gehen ... Engel auf Reisen Direkt zum Seiteninhalt Hauptmenü Route Amerika Japan Hongkong Südostasien
engelaufreisen.ch Engel Reisen Weltreise Gisela
324 Home wellness reisen

Immer mehr Urlauber verbinden ihre jährlichen Reisen mit Wellness vor allem wer im Alltag ... wellness reisen Navigation überspringen Home Anwendungen Ernährung Übersicht . Wellness Reisen
wellness-reisen.ch
325 WAESPIREISEN Transporte GmbH waespi

Carreisen (1671 Plätze) BusBetrieb KipperBetrieb Schneeräumungen Strassenreinigungen ... Mietbus Dienstleistungen WAESPI-REISEN Transporte GmbH Wir ihre WAESPI Reisen sind ein Carunternehmen
waespi-reisen.ch Waespi Reisen Transporte Car Doppelstöcker Reisebus Mietbus Kleinbus
326 Südamerika Westen Andenländer Tourismus lateinamerika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen im südamerikanischen Westen ... Trekken in Chile Eine Tour zum Mars. Eine Reise zu den Vulkanen der Atacama-Region in Chile führt
suedamerika-anden.ch Lateinamerika Latin Latein Spanisch Südamerika South America Mittelamerika
327 Reiseguide.ch Informationen zum

reiseguide.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-guide Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-guide.ch
328 Reiseschweiz.ch Informationen zum

reiseschweiz.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-schweiz Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-schweiz.ch
329 Reiseportal.ch Informationen zum

reiseportal.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-portal Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-portal.ch
330 Reisetip.ch Informationen zum

reisetip.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-tip Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-tip.ch
331 Reisetipps.ch Informationen zum

reisetipps.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-tipps Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-tipps.ch
332 Reisetips.ch Informationen zum

reisetips.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-tips Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-tips.ch
333 Reiseangebot.ch Informationen zum

reiseangebot.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... Domain erwerben Sie können die Domain reise-angebot kaufen! reise-angebot Weitere Links
reise-angebot.ch
334 Reiseapotheke.ch Informationen zum

reiseapotheke.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-apotheke Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reise-apotheke.ch
335 Reisenangebote.ch Informationen zum

reisenangebote.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reisen-angebote Weitere Links Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm
reisen-angebote.ch
336 Reisemagazin.ch  Diese Website steht zum

Diese Website steht zum Verkauf! reisemagazin.ch ist die beste Quelle für alle Informationen die ... reise-magazin Domain erwerben Sie können die Domain reise-magazin für EUR vom Inhaber
reise-magazin.ch
337 Karibik Segeln Mitsegeln Kojencharter Karibik

Karibik Segeln auf Segelyacht Paloma II Kojencharter bei einem erfahrenen Skipperpaar. Wir ... Paloma II Reisen Tauchen Schnorcheln Segeln Schenken Sie uns Ihr Vertrauen und wir belohnen
karibik-segeln.ch Karibik Segeln Mitsegeln Kojencharter
338 Kanada 2011 wirsindunterwegs

Reisen Kanada wirsindunterwegs ... auf unserer Reise-Webseite Auf dieser Seite finden alle Interessierten einen Einblick in unsere
wirsindunterwegs.ch Wirsindunterwegs Kanada Reisen Camper
339 Reiseexperte.ch Informationen zum

reiseexperte.ch ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis ... reise-experte Domain erwerben Sie können die Domain reise-experte kaufen! Weitere Links
reise-experte.ch
340 Voyages et Culture voyages

Voyages et Culture CVC SA Reisen und Kultur CRK AG ... Reisen sind unsere Leidenschaft Bederstrasse CH- Zürich Tel + +
reisen-und-kultur.ch Voyages Culture Voyage Culturel Groupe Individuel Passion Chine
341 Home :: Destour Reisebüro Destour

Destour Reisebüro Reisen Murten Ferien ... Gutscheine Partner Destour Reisen Hauptgasse Murten destour
destour.ch Destour Reisebüro Reisen Murten Ferien
342 Fritsche Reisen :: Home Ferien

Fritsche Reisen AG Zürich Ihr USA amp; Kanada Spezialist. ... Reisebranche Mitglied Schweizerischer Reisebüro-Verband Fritsche Reisen AG Druckansicht
fritschereisen.ch Ferien Geschäfts Und Gruppenreisen USA Amerika Kanada Reisebüro
343 Altun.ch reisen ferien altun

www.altun.ch Reisemarkt Schweiz. Tausende Reiseangebote Last Minute Angebote Links. reisen ferien
altun-reisen.ch Altun Altunconsulting Reisen Ferien Travel Ferien Reisen Urlaub
344 PRIORI Madagaskar Afrika

PRIORI bietet erlebnisreiche Reisen in Madagaskar. Wir sind vor Ort in Antananarivo.
afrotravel.ch Afrika Africa Madagaskar Madagascar
345 Reiseberater.ch Informationen zum

reiseberater.ch ist Ihre erste und beste Informationsquelle über Reisen Hier finden Sie auch weitere ... Weitere Links reise-berater Domain erwerben Sie können die Domain reise-berater kaufen
reise-berater.ch
346 Reiseshop.ch Informationen zum

reiseshop.ch ist Ihre erste und beste Informationsquelle über Reise shop Hier finden Sie auch ... Weitere Links reise-shop Domain erwerben Sie können die Domain reise-shop kaufen! Weitere
reise-shop.ch
347 Vietnam Reise mit Vietnam

... Auf einer nach Wunsch zusammengestellten Reise führe ich private kleine Gruppen persönlich und flexibel
hubivietnam.ch Vietnam Reisen Privat Indivduell Kleine Gruppe Persönlich Wunsch
348 Sie entscheiden wohin die Rundreise

Individuelle Reisen nach Sizilien im Mercedes V zu attraktiven Preisen. Die Alternative zur Bahn und ... Philosophie Privatkunden Sizilien Reisen Tagesreisen Firmenkunden Vereine Bands Taxi Transfer
idriveforyou.ch Rundreise Tagesreisen Urlaub Ferien
349 Cornelia Cornelia auf Griechenland

Lesen Sie meine Reiseberichte sehen Sie Fotos an lassen Sie uns an Ihren ... > Kefalonia > Kontakt > Aktuell > Mein Reise-Blog ja wer bin ich? Ich verheiratet mit einem lieben Mann
cjost.ch Griechenland Orte Reisen Entdecken Landkarte Tourist Bewertung Interesse
350 Reiseportal24.ch Last Minute Patnic GmbH Reiseportal
5430
Wettingen
Reiseportal24.ch Last Minute Reisen und günstige Reiseangebote auf dem Reiseportal24.ch! Flüge Mietwagen ... Partnerseiten Willkommen beim ReisePortal.ch Hier finden Sie günstige Lastminuteangebote
reiseportal24.ch Reiseportal Reise Portal Reisen
351 Marokkotravel.ch Mystik in Reisen

MarokkoTravel schöne Reisen in der Wüste Marokkos ... an die Wüste.... Für Informationen zu meinen Reisen klicke bitte hier oder interessiert Dich meine Lebensschule
marokko-travel.ch Reisen Marokko Kamel Wüste
352 Itravel.ch Ihr Reisebüro Alaska

Unser Team gestaltet Ihre Reise ganz nach Ihren individuellen Bedürfnissen. Die ausgeschriebenen Reiserouten sind Vorschläge ... Ihre Reise ganz nach Ihren individuellen Bedürfnissen. Die ausgeschriebenen Reiserouten sind Vorschläge
itravel.ch Alaska Reisen Kanada Reisen Costa Rica
353 Start Deyvs Reisen orte

Lesen Sie unsere Reiseberichte sehen Sie Fotos an lassen Sie uns an Ihren ... zu aktualisieren. > Start > Über mich > Mein Reise-Blog > Reisealbum > Kontakt Deyvs Reisen Willkommen
tanev.ch Orte Reisen Entdecken Landkarte Tourist Bewertung Interesse Blog
354 Monte San Juan Reise

Monte San Juan Reise www.argentinienchilereisen.ch ... Monte San Juan Reise Corona del Inca Die Puna Fotos aus den Reisen Flussueberquerungen
argentinien-chile-reisen.ch
355 Segeln Mitsegeln Kojencharter Karibik Karibik

Karibik Segeln auf Segelyacht Paloma II Kojencharter bei einem erfahrenen Skipperpaar. Wir ... mit Segelyacht Paloma II Reisen Tauchen Schnorcheln Segeln Schenken Sie uns Ihr Vertrauen und wir belohnen
paloma-segeln.ch Karibik Segeln Mitsegeln Segeltörn
356 Südamerika Osten Amazonasländer Tourismus lateinamerika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen im südamerikanischen Osten ... und war verrufen. Jetzt ist das Viertel Pelourinho plötzlich hip - und lohnt eine Reise. Vorgestellt von Spiegel
suedamerika-amazonas.ch Lateinamerika Latin Latein Spanisch Südamerika South America Mittelamerika
357 Raemselbahn Reiser

Gartenbahn Unteraegeri Reiser Christian ... die ich auf eine Rundfahrt mitnehmen darf. Auf Ihren Besuch in Unterägeri oder Einsiedeln freut sich Christian Reiser
raemselbahn.ch Reiser Christian Gartenbahn Rämselbahn Unterägeri
358 Teletext TRAVEL teletext Last

SWISS TXT teletext travel Reisen schnell gebucht Über 150'000 Reiseangebote auf einen Blick. ...  teletext TRAVEL - teletext travel – Last Minute Reisen und Lastminute Angebote vergleichen
teletexttravel.ch Last Minute Lastminute Lastminute Reisen
359 Myanmarreise.ch :: Myanmar Reise Magnolia Travel GmbH
8002
Zürich
Für Entdeckerinnen und Erlebnishungrige mit einer Vorliebe für Stil und Lust auf Authentisches. Die Myanmar ... Myanmar Reisen Myanmar Infos Myanmar Visa Team Blog Kontakt Myanmar Infos Myanmar Visa
myanmarreise.ch
360 LastminuteAngebot.ch Reisen Lastminute

Lastminute Börse Reisen günstige Reiseangebote im Internet Reisebüro online vergleichen buchen! Arrangement
lastminute-angebot.ch Lastminute Börse Reisen Günstige
361 Südrussland Reisen Herzlich Kalmycken
4052
Basel
Kommen Sie mit Südrussland Reisen zum Kaspischen Meer oder an das Schwarze Meer und lernen ... ? Südrussland Reisen Südrussland Reisen Startseite Republik Kalmückien am Kaspischen Meer
suedrussland.ch Kalmycken Soschi Derbent
362 EagleCampers WohnmobilVermietung in Kanada WohnmobilVermietu

WohnmobilReisen ... Links Website Support Sie sind hier Startseite Eagle Campers Wohnmobil-Reisen in Kanada
eagle-campers.ch WohnmobilVermietung WohnmobilReisen Rental Canada
363 Reisen und Tickets zum FussballReisen

Fußballreisen und Fußballtickets zu allen Vereinen auf der ganzen Welt. Erleben Sie mit FussballTour.ch ein ... Direkt zum Inhalt FussballTour FAQ Referenzen Firmen Blog Reisen Tickets Clubs Galerie Kontakt
fussballtour.ch FussballReisen Premier League Champions League
364 Ein Herz für Singles Reisen

Singles suchen Singles um gemeinsam zu verreisen. Das Portal " EIn Herz für Singles ... und Alleinreisende - die etwas andere Partnerbörse - kennenlernen um gemeinsam zu reisen - oder vielleicht auch mehr
clubschiffzentrale.ch Reisen Singlebörse Kreuzfahrten Clubreisen
365 Alp Reisen AG | Das

Das umfangreichste OnlineTourismusreiseportal der Türkei! OnlineReservierung Hotels (Luxeriös modern Familie günstig ...  Alp Reisen AG PAUSCHALREISE HOTEL FLUG TRANSFER MIETWAGEN BLAUE REISE AUSFLÜGE
alpreisen.ch Das Umfangreichste OnlineTourismusreiseportal Der Türkei! OnlineReservierung Ho
366 Reisebüro für Russland ganz

Willkommen bei Atlas Reisen Ihrem Spezialist für Reisen nach Russland Ukraine Zentralasien ... Reisen in Russland Zentralasien Iran Marokko und den Kapverden Als spezialisierter Reiseveranstalter
kameltrek.ch Ganz Eine
367 Reise nach Kanada und Australien

16 Wochen unterwegs in Kanada und Australien. ... und von meiner Reise durch Australien. Viel Vergnügen! Menü Home Tagebuch Kanada Tagebuch Australien Reiseprogramm
snowsun.ch Australien Australia Kanada Canada
368 Willkommen bei steFan Reisen Airport
78244
Bietingen
Ihr Partner fuuml;r Karibik Reisen Fluuml;ge Osteuropa Visum Airport Taxi Und bei uns haben Sie ... Willkommen bei steFan Reisen Ihr Partner für Karibik Reisen Flüge Osteuropa Visum Airport Taxi
stefanreisen.ch Airport Transfer Taxi Airport Taxi Airporttranfertaxi
369 Reisewecker kaufen Shop ReiseWecker Reisewecker

Der Reisewecker sollte klein und handlich sein damit man ihn im Gepäck leichter verstauen ... Reisewecker .ch Reisewecker kaufen Der Reisewecker ist für viele Urlauber nicht mehr wegzudenken
reisewecker.ch Reisewecker Funk Digital Analog Mechanisch ReiseWecker
370 Home Marco

Webseite für Freunde Bekannte und alle die sich für unsere Reise interessieren ... -Bierli Hochzeit Bea Marco Weitere Reisen Urlaub Malaysia .- .. Kefalonia . - ..
mates.ch Marco Bertossa Reise Weltreise
371 Horner Reisen HornerReisen

... Willkommen bei Horner Reisen Tafers. Klicken Sie auf das Horner-Logo um die deutschsprachige
romandie-voyages.ch HornerReisen Horner RomandieVoyages Reisen
372 Carunternehmen Carfahrten Schweiz Carunternehmen

Carunternehmen Carfahrten Schweiz Hochzeitsfahrten Frey Reisen AG ... Hauptmenü Zum Inhalt wechseln Zum sekundären Inhalt wechseln Home Reisen Tagesfahrten Unsere
freyreisen.ch Carunternehmen Carfahrten Schweiz Hochzeitsfahrten
373 Singlereisen SingleReisen Dating Treff AG Singlereisen
8332
Russikon
Singlereisen mit 50% Frauen 50% Männern einer Altersgruppe. Gemeinsam mehr erleben Sommerreisen mit ... Fragen Antworten Warum Single-Reisen Buchung und Zahlung Mit Reisegarantie Zimmerbelegung
single-reisen.ch Singlereisen Singlereise Single Reisen Single
374 Phnom Penh Kambodscha

Phnom Penh die Hauptstadt von Kambodscha bietet viele Kulturschätze und Sehenswürdigkeiten. Die Stadt ist ... Land. Phnom Penh gilt als idealer Ausgangsort für Kamboscha Reisen. Empfehlen Kambodscha Reisen
phnompenh.ch
375 Individuell Reisen mit Ueli Reisen
4058
Basel
Ueli Blaser ist Experte für Indienreisen. Er kennt pflegt enge Kontakte zu Einheimischen und kennt ... Skip Porträt Nächste Reisen Beratung Eindrücke Ueli's Hilfsprojekt Links Kontakt Individuell
individuell-reisen.ch Reisen Indien Individuell Ueli Blaser
376 Mieten und vermieten Ferienhäuser mieten

mieten und vermieten Ferienhäuser Apartments und Hotels Technik Computer und Elektronik Fahrzeuge ... Sport und Reisen Sport und Ausrüstung - Jugend- Kinder- und Familienreisen - Sport- und Fitnessreisen
tribook.ch Mieten Und Vermieten Ferienhäuser Apartments Und Hotels
377 Bauberger ? so reisen Industrieumzüge

Bauberger so reisen Farbiken® BaubergerMechanikprofis planen und realisieren weltweit anspruchsvolle Projekte als Generalunternehmung: Ein zentraler ... Zur Kontaktseite Sitemap anzeigen Suche anzeigen Bauberger ? so reisen Fabriken® Menu Dienstleistungen Equipment
bauberger.ch Industrieumzüge Maschinenmontage Instandhaltung Schwergutlager
378 Blue World Tauchschule Blue World dive & more GmbH diving
9524
Zuzwil
Blue World dive more GmbH Tauchschule Tauchshop Reisen Aussenfuellstation ... Öffnungszeiten Neuigkeiten Reisen Über uns Kurse Bildergalerie Tauchgruppe Aussenfüllstation
blue-world.ch Diving Tauchen Tauchschule
379 SindbadReisen Spezialist für Nilkreuzfahrt
8902
Urdorf
SindbadReisen Spezialist für Nilkreuzfahrten in Ägypten: Nilkreuzfahrt zwischen Luxor und Assuan ... Sindbad-Reisen Fotogalerie Erlebnisberichte und Impressionen Reisetipps Ausflugstipps Sindbad-Reisen
nilkreuzfahrten.ch Nilkreuzfahrt Nilkreuzfahrten Nilfahrt Dahabeyyat
380 Brasilien Bahia Reisen abenteuer

Organisieren von Abenteuer Entdeckungs Reisen in Bahia Brasilien. Verkauf von Immobilien in Bahia Brasilien
rufima.ch Abenteuer Brasilienreisen Bahiabrasilien Immobilienverkauf
381 Agência Brasil · Reisen Brasilien

Agência Brasil das unkomplizierte Reisebüro für alle Reisedestinationen in Brasilien. Wir sprechen Portugiesisch Deutsch
a-brasil.ch Brasilien Brasilien Reisen Reisen
382 Safari Reisen EFAR Reisen AG africa
4123
Allschwil
Kenya Ferien und Kenya SafariFerien mit African Safari Club. Kombination von Safari und Hotelaufenthalt in ... Abenteuer und Freizeit Alles Wissenswertes Kontakt Newsletter über uns AGB's Safari Reisen
kenyasafari.ch Africa Safari Kenya Kenia
383 Rundreisen reisen

golden age Reisen: Die Welt für Menschen ab 50 ... wunderbare Canyons eine einzigartige Tier- und Pflanzenwelt erwarten Sie auf dieser Reise
goldenage-reisen.ch Reisen Golden Age 50 60
384 Indien Henry Photography Hoststar - Multimedia Networks AG Fotografie
3312
Fraubrunnen
... Bilder Marc Henry Kontakt Reisen Indonesien Kambodscha Laos Nepal Malaysia Indien Thailand Vietnam
henry-photography.ch Fotografie Photography Marc Henry
385 Billige Flüge Hotels STA Travel AG Flug
8001
Zürich
Wir bieten günstige Flüge in die ganze Welt Around the World Tickets Hotels ... World Beliebte Strecken Around The World Katalog Airpässe Gabelflüge Reisen Reisen Von der Rundreise
statravel.ch Flug Flüge Billigflüge Around The
386 Mit Pinsel und Objektiv Aquarell

Eindrücke von Reisen werden mit Pinsel und Objektiv erfasst ... oder auf Reisen gewonnen wurden Chaniá - durch's Objektiv gesehen Chaniá - mit dem Pinsel erfasst
atelier-am-bodensee.ch Aquarell Foto Pinsel Objektiv
387 Findyourholiday.ch Reisen einfach Hotels

findyourholiday.ch Hotel oder Ferien einfach günstiger. Bei uns findet ihr die besten Reiseportale im ... findyourholiday - Reisen einfach günstiger Reif für die Insel oder für ein Abenteuer. Bei uns findest
findyourholiday.ch Hotels Reisen Reiseportale Ferien
388 PRIORI Madagaskar Afrika

PRIORI bietet erlebnisreiche Reisen in Madagaskar. Wir sind vor Ort in Antananarivo.
afrika-travel.ch Afrika Africa Madagaskar Madagascar
389 Kolumbien Reise Reisen Südamerika

Rundreisen in der Region im Nordwesten von Südamerika Informationen für Ihre Kolumbien Reise ... dass man vor und während der Reise gewisse Regeln beachtet. Von einer Reise mit ungenügender
kolumbien-reisen.ch Südamerika Kolumbien Anden
390 Island Reise Reisen Island

Rundreisen in den Regionen im Nordwesten von Europa Informationen für Ihre Island Reise ... ein lohnenswertes Ziel für eine Reise darstellt Mehr Informationen... Ein paar Bilder dieser Region finden
island-reise.ch Island Europa
391 Stofer Foletti's Familienwebsite mit Stofer

Homepage of StoferFolettis Website ... Willkommen auf unserer HP! Daniela Surfin' in the Kitchen Fredy Bigboards Jasmin Unsere Reisen
stofer-foletti.ch Stofer Foletti's Familienwebsite Reisen Snowboard Tragetüchern
392 Lebe Deinen Traum von Reisen

Reisen ... Der Reisebericht von Cornelia und Peter Spreiter CH- Zizers
lebedeinentraum.ch Reisen Wohnmobil Camper Traum
393 Boatworld.ch informationen rund Boatworld

Informationen rund ums Boot grosser Bootsmarkt Gebrauchtboote Bootszubehör Reisen Kreuzfahrt ... Gebrauchtboote Bootsmessen Events Bootszubehör Segelsport Reisen Lifestyle Kontakt Home Informationen rund ums
boatworld.ch Boatworld Boot Schweiz Bootsmarkt
394 Ryffel AG Ihr ryffel

Den Kunden bieten wir eine Vielfalt an Reisen speziell individuelle Arrangements an. Mit
ryffeluster.ch Ryffel Reisen Uster Dübendorf
395 Reisebüros Last Minute last

Reisedatenbank für Reiseangebote aller Reisebüros und Veranstalter: Reisen Flüge Ferien Badeferien und
reisefritz.ch Last Minute Reisen Lastminute Reisebueros Badeferien Reiseangebote Lastminit
396 Last Minute und mehr Last

Last Minute Reisen Pauschalreisen Flüge Hotels Ferienwohnungen Kreuzfahrten
swissdiscover.ch Last Minute Reisen Urlaub Ferien
397 Webtourist Webtourist

Von der Hotelsuche über Reise Expeditionsgestaltung bis hin zur Hotelreservierung ... der Pisten genießen? Von der Hotelsuche über Reise- Expeditionsestaltung bis hin zur Hotelreservation
webtourist.ch Webtourist Reisen Hotel Hotelsuche
398 EveLori's Heimseite Reise

www.evelori.ch Internetseite von Lorenz und Evelyne (Reise Panamericana Velo Fahrrad) ... Du mußt in Deinem Browser JavaScript aktivieren um Google Maps zu verwenden Reise-Heimseite
evelori.ch Reise Panamericana Velo Fahrrad
399 Reisenimrolli.ch: Unterwegs im Rollstuhl Reisen

Rollstuhl Reiseberichte Thema Reisen barrierefrei ... über uns Reisen Nützliches Kontakt Hausbau Links Projekt Bulli reisenimrolli ist eine Plattform
reisenimrolli.ch Reisen Rollstuhl Ferien Rollstuhlreisen
400 Argentinien Reise Reisen Südamerika

Rundreisen in der Region im Südwesten von Südamerika Informationen für Ihre Argentinien Reise ... und sollte deshalb sicher drei Tage der Reise ausmachen. "Trockene Sandfläche" hiess einst
argentinien-reise.ch Südamerika Argentinien Anden
401 Italien Reise Reisen Italien

Rundreisen in den Regionen im Südwesten von Europa Informationen für Ihre Italien Reise ... von DestinationenCH - Datum .. Tags Emilia-Romagna Busseto Giuseppe Verdi Lombardei Reisen zur Musik
italien-reise.ch Italien Europa
402 4x4 PowerShop Jeep

Webseite über Reisen und Jeep ... YJ Reisen Ardeche Frankreich Crans montana Pyrenaen Reko Ardeche Ardeche Crans Montana
4x4-power-shop.ch Jeep Reisen Wrangler JK
403 Mit RothReisen machts Spass! ROTH Reisen + Transporte AG Roth
9630
Wattwil
... Dienstleistungen Wir über uns Kontakt Links Mit Roth-Reisen machts Spass! Machen Sie Veloferien mit uns! Geniessen
roth-reisen.ch Roth Reisen Transporte Umzug
404 Turus.net Magazin Fußball Ströer Digital Media GmbH Sport
22769
Hamburg
turus.net ist das Magazin für Reportage und Fotos aus Fußball Fankultur Radsport
turus.ch Sport Fußball Fankultur Radsport
405 Irland Reise Reisen Irland

Rundreisen in den Regionen im Nordwesten von Europa Informationen für Ihre Irland Reise ... Dublin Irland Britische Inseln James Joyce Fünf Gründe für eine Reise nach Dublin in Irland Stadt
irland-reise.ch Irland Europa
406 Reisen und Fotografieren Private

Platz für Ihren Slogan ... my-photo-gallery Reisen und Fotografieren Startseite Karten Kalender Poster... Links FASZINATION
my-photo-gallery.ch Private Webseite Fotografieren Reisen Karten
407 Namibiareisen Marokko Reisen Holdener Reisen GmbH Reisen
8843
Oberiberg
... Nr. Begleitetes Reisen Katalog Reisen Kontakt Holdener Reisen GmbH Laburgstrasse CH-
holdener-reisen.ch Reisen Begleitet Behütet Gruppenreisen
408 Marokko Reisen vom Spezialisten Kameltrekking

Sahara unvergessliche Erlebnisse in der Sahara in Algerien Libyen Marokko ... Tombouctour GmbH Im Brünneli CH- Forch Aesch infotombouctour +
tombouctour.ch Kameltrekking Trekking Wandern Wüstentrekking
409 Traumhafte Ferien günstig buchen Kuoni Reisen AG Flug
8010
Zürich
Ab an die Sonne! Finden Sie Ihren Bestpreis für Badeferien einfach bequem online buchen bei ... Gauguin Cruise.. Phoenix Reisen Ponant Princess Cruises Regent Seven Seas Royal Caribbean Int.. Sea Cloud
helvetictours.ch Flug Hotel Ferien Reise
410 HOME KOPP REISEN GmbH Reise
8552
Felben-Wellhausen
ERHOLEN und GENIESSEN ENTDECKEN Sie die bunte Reisewelt mit KOPP REISEN! ... menu HOME ANGEBOT ÜBER UNS KONTAKT KOPP REISEN GmbH Webdesign by Einfach schön ... KOPP REISEN
koppreisen.ch Reise Transport Fahrt Ferien
411 Christina Gloor Reisen GmbH Christina

... by Christina Gloor Reisen GmbH – speziell individuell Bergstrasse Windisch
christina-gloor-reisen.ch Christina Gloor Reisen GmbH Beratung Windisch
412 Sternenboutique Alina Daniela Sternenboutique

Home Sternenboutique Alina Daniela Reis Hauptstrasse 14 6280 Hochdorf ...  Sternenboutique Alina Daniela Reis Hauptstrasse Hochdorf >>> SternenBoutique Alina
sternenboutique.ch Sternenboutique Alina Beratungen Seminare Vorträge
413 Troya Reisen Reisen

Webdesign by Hoffmann ITBüro
troyareisen.ch Reisen Troya
414 Zysset Bistrobusse: Zysset Bistrobusse
3116
Kirchdorf
Zysset Bistrobusse Die bequeme Art mit dem Bus zu reisen. ... Reisen Last Minute Galerie Kontakt Search Zysset Bistrobusse - Ihr Reisepartner Messen Ausstellungen
zysset-bistrobusse.ch
415 Startseite Obwalden

Obwalden Sachseln Website Websiten Administration Tetraplegie Reisen ... und Melanie reisen Willkommen Ein kleiner Einblick in meine Welt des Ausdrucks.... Viel Spass wünscht
melanievonah.ch Obwalden Sachseln Website Websiten Administration
416 Home Maho-Hofer GmbH ungarn
6330
Schweiz
Ungarn Dental Reisen mit gut betreuten Kleingruppen. Machen sie aus Ihrem Zahnarztbesuch ein Ferienerlebnis ... Kronen Implantate Zahnarzt Preisliste Reise Unterkunft Reise Transport Unterkunft Die Zähne
ungarn-dental.ch Ungarn Reisen Dental Reisen Zahnarzt
417 Afrika Rundreisen Afrika Afrika

Afrika Rundreisen Afrika Safari Südafrika Reisen Kilimanjaro Besteigung A+M Africa Tours
africatours.ch Afrika Rundreisen Afrika Safari Südafrika Reisen
418 Wohnmobilreisen Wohnmobil

Reisen mit dem Wohnmobil; Reisen mit Hund; Hund und Wohnmobil; Rimor Reisemobil; Ferien mit Wohnmobil ... Seit Oktober geniessen wir Reisen mit unserem Wohnmobil und berichten Euch gern über unsere
womotours.ch Wohnmobil; LRimor; Ford; Reisen; Piemont; Suedtirol; Womotours
419 Flüge vergleichen und günstig urlaub

Reisen zu günstigen Preisen sofort online buchen +++ Top Angebote für Ihren Urlaub ... Wochen HP im DZ Jetzt schon ab € Reisen Frühbucher Pauschalreisen All Inclusive Beauty Wellness
aerolloyd.ch Urlaub Reise Urlaub Günstig Urlaub
420 Kanada Nordamerika Tourismus nordamerika

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Kanada ... Reise - Exotic Ontario The small trips. Ein Artikel aus der National Post Bearbeitet
kanada.ch Nordamerika Northamerica Kanada Usa Usa Kanada Kanada Canada
421 Swissinserate.ch | Alle Andere Alle

Alle Andere Wohnungen Immobilien Computer Unterhaltungs elektronik Möbel Einrichtungen Gesundheit und Medizin ... Einrichtungen Gesundheit und Medizin Haushalt Persönliche Inserate Freizeit Hobby Sport Ferien Reisen
swissinserate.ch Alle Andere Wohnungen Immobilien Computer Unterhaltungs
422 Lastminute Reise Angebote

Verreisen Sie gemeinsam mit Urlaubsreise24 in interessante Länder reizvolle Ferienregionen erlebnisreiche Städte. Top ... » Costa Azahar » Costa Blanca » Costa Brava » Costa Del Almeria » Costa Del La Luz » Reisen Costa Del Sol
urlaubsreise24.ch
423 Travelport.ch Reisen weltweit travelport

travelport.ch Aktuelle Reiseangebote und umfangreiche Reiseinformationen bei travelport.ch für Ihre nächste Urlaubsplanung von ... Urlaubsreisen Hotels Lastminute Reisen All-Inclusive Club- oder Familienurlaub. Buchen Sie hier bei travelport
travelport.ch Travelport Schweiz Urlaub Ferienwohnung Ferienhaus
424 SCHWEIZERREISEN.CH PORTAL fuer reisen
6383
Dallenwil
www schweizerreisen ch Die Suchmaschine das Portal zum Reisemarkt Schweiz Tausende Reiseangebote Last Minute
schweizerreisen.ch Reisen Ferien Travel Ferien
425 Botswana Reisen Tansania
8702
Zollikon
Ihr Reisebüro für Afrika Safari Reisen Botswana Reisen Tansania Reisen Namibia Reisen
swissafrican.ch
426 Schweizerische Datingplattform für Reisen
1950
Sion
Singleactive : Schweizerische Datingplattform für Reisen und Freizeitaktivitäten für Singles und Personen die freundschaftliche Bekanntschaften oder ... verbunden mit Vorschlägen für Events Aktivitäten und Reisen. DAS LABEL SINGLEFRIENDLY Dank dem Label
singleactive.ch
427 OnlineReisesuche.ch | günstige Reisen ATB International Services & Consulting GmbH
06108
Halle
Günstigen Urlaub Pauschalreisen finden jetzt bis zu 70% bei OnlineReisesuche sparen. Günstige Pauschal ... Jetzt online Vorteil nutzen und CHF sparen! Buchen Sie Ihre Reise auf online-reisesuche und Sie erhalten
online-reisesuche.ch
428 MyTrails Caroline

myTrails Reise durch Neuseeland und Asien ... Message Board Tagebuch Fotos Unsere Reise Home Willkommen auf myTrails Neuseeland Auckland
mytrails.ch Caroline Gölz Thomas Enzler Reisen Neuseeland Asien Kambodscha
429 Introseite Burgturm Reisen Ferien

Hier gibt es die besten Ferien! So individuell wie Sie. Badeferien Flugreisen ... Introseite - Burgturm Reisen AG Direkt zum Seiteninhalt Hauptmenü Zurück zum Seiteninhalt ZurÃ
burgturmreisen.ch Ferien Reisen Urlaub Abenteuer
430 Swissinserate.ch | Alle Andere Alle

Alle Andere Wohnungen Immobilien Computer Unterhaltungs elektronik Möbel Einrichtungen Gesundheit und Medizin ... Einrichtungen Gesundheit und Medizin Haushalt Persönliche Inserate Freizeit Hobby Sport Ferien Reisen
gratisinserateschweiz.ch Alle Andere Wohnungen Immobilien Computer Unterhaltungs
431 Bio Rohwaren Tiefkühl Gemüse Oliver

Oliver Bio Rohwaren Getreidehandel Weizen Reis Tiefkühlgemüse Fruchtsäfte Konzentrate Eichenfurnier Zucker
oliver-zollikon.ch Oliver Bio Rohwaren Getreidehandel Bioweizen Biogetreide Reis BioZucker
432 Arktis und Antarktis Tourismus arktis

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen der Antarktis und
arktis-antarktis.ch Arktis Arctic Antarktis Antarcica Frühling Sommer Herbst Winter
433 Home/Startseite Brücke der Jürgen

Indien Varanasi Südindien Reisen Nähe zu Kultur und Menschen ... erleben Kultur Tempel Natur Kulturbewusst Reisen Palmblatt Horoskope Reise-Leitungen Kontakt
shivnyberg.ch Jürgen Berg Indien Varanasi Indien Reisen
434 Burgturm Reisen AG Ferien
5707
Seengen
Hier gibt es die besten Ferien! So individuell wie Sie. Badeferien Flugreisen ... Burgturm Reisen AG > Burgturm Reisen AG Direkt zum Seiteninhalt Hauptmenü Home Über uns Büro
mellowadventures.ch Ferien Reisen Urlaub Abenteuer
435 Massgeschneiderte Mietwagenrundreisen und Gruppenreisen suja reisen gmbh Agrotourismus
8048
Zürich
Auf unseren Reisen lernen Sie Land und Leute hautnah kennen mit massgeschneiderten Individualreisen oder ... und Neujahr verreisen sollen? Hier finden Sie Ihre Traumreise.... Reisen Sie nicht gerne allein? Entdecken
suja-reisen.ch Agrotourismus Wanderferien Reitferien Vulkantouren
436 MaledivenFerien.ch | Traumhafte Reisen travel worldwide AG Malediven
8001
Zürich
Auf MaledivenFerien.ch finden Sie die besten Inseln für Ihren Urlaub! Reisen Sie mit uns gut ... Luxusklasse Inseln A-Z Tauchsafaris Malediven Ferien Traumhaft schöne Reisen ins Inselparadies Mitten
malediven-ferien.ch Malediven Ferien. Malediven Urlaub.
437 Jgrand Webshop Qualitäts

Hochwertige Reisekoffer Kollektion Rollkoffern Reise Rucksack sowie WorldAdapter. ... Bedienungsanleitung > pdf Reise-Accessoires CHF . Reise Adapter Komptabilität V/V CHF . Handy LadegerÃ
jgrand.ch
438 Günstige Flüge Belgrad |

Reisen das ist unsere Leidenschaft schon seit 1982. Seit diesem Jahr steht Miro Reisen ... Reisen Perimex AG Solothurnerstr. CH- Basel Schweiz Unsere Leistungen Flugtickets Badeferien
miroreisen.ch
439 Www.andonyka.ch Ägypten

Reisen
andonyka.ch Ägypten Argentinien Bali Chile Costa Rica Ecuador Galagapos
440 FinSTours Ihr Spezialist finstours

Individuelle Reisen nach Finnland und Skandinavien Spezialist fuer Angel und Jagdreisen agence de ... -Mail-News Reiseinfos Allg. Bedingungen Gästebuch Presseberichte Links fins-tours sa bachacherweg ch
finnlandreisen.ch Finstours Fischen Fischerreisen Fischerreisen
441 PRIORI Madagaskar Afrika

PRIORI bietet erlebnisreiche Reisen in Madagaskar. Wir sind vor Ort in Antananarivo. PRIORI vous propose
mosambik.ch Afrika Africa Madagaskar Madagascar
442 Willkommen Reisen
9445
Rebstein
GRAFITI Reisen Das unkomplizierte Reisebüro ... requires Javascript Welcome Grafiti Reisen Bei Grafiti Reisen ist man mit jedem Reisewunsch
grafitireisen.ch Reisen Travel Reisebüro Grafitireisen
443 Chile Reise Reisen Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Chile Reise ... . Chile ist schon wegen seiner Form und der Erstreckung durch Breitengrade etwas Besonderes. Ein Reise
chile-reisen.ch Südamerika Chile Anden
444 Reisen für Alle

... Zur Navigation Zum Inhalt Reisen für Alle Darstellung anpassen Kontrast Schriftgröße Navigation
deutschland-barrierefrei-erleben.ch
445 Flamingoreisen Ihr Reisebüro Gesundheitsreisen
71672
Marbach a. Neckar
Flamingoreisen.ch Ihr kompetentes Reiseportal für die deutschprachige Schweiz. Wir finden die richtige Reise für ... suche Suchen Tolle Reisen zu fairen Preisen! Telefon Home Reiseangebote Reiseangebot
flamingoreisen.ch Gesundheitsreisen Fernreisen Reisen Mit ärztlicher Begleitung
446 Bolivien Reise Reisen Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Bolivien Reise ... am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Bilder dieser Region finden
bolivien-reisen.ch Südamerika Bolivien Anden
447 Aquasy® Trinkwasserfilter Der aquasy

Der Aquasy® Wasserfilter ist ein günstige Haushalt und ReiseWasserfilter für Haushalt Reisen oder Camping. ... Wasserfilter Sauberes Wasser für jeden Haushalt AT CH DE EN ES FR IT PT Home
aquasy.ch Aquasy Reisefilter Trink Wasser Filter Filtert
448 Ferien buchen | Buchen Billigflüge

Buchen Sie günstigen Urlaub an allen Reisezielen mit Gotogate! Wir bieten Reisen zu günstigen Preisen. ... Sie Ihre Reise hier Hin/Rück Einfach Von Nach Nur Direktflüge Hinreise Rückreise REISENDE Erwachsener
gotogate.ch Billigflüge Günstige Flüge Flüge Flugtickets
449 Norwegen Reise Reisen Nordeuropa

Rundreisen in den skandinavischen Regionen im Norden von Europa Informationen für Ihre Norwegen Reise ... durch ihr freundliches Gemüt ihre Offenheit und ihre gelebte Geschichte jedem Touristen seine Reise
norwegen-reisen.ch Nordeuropa Norwegen
450 Dänemark Reisen Reisen Nordeuropa

Rundreisen in den skandinavischen Regionen im Norden von Europa Informationen für Ihre Dänemark Reise ... ich diese europäische Region am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar
daenemark-reisen.ch Nordeuropa Dänemark
451 Luxus Hotels vom Experten luxus
78462
Konstanz
persönliche Beratung und bester Service durch jahrzehntelange Erfahrung bei Ticket Shop. ... Exklusives Reisen Stranden Sie im Paradies ... Exklusives Robinson Crusoe Gefühl ... Das kleine
exklusives-reisen.ch Luxus Hotel Reisen Destinationen Buchen Exclusiv Exklusiv
452 Super Last Minute HoliPort GmbH
92655
Grafenwöhr
Last Minute Angebote Reisen wie an der Reisebörse am Flughafen. Beratung wie im Reisebüro. ... Merkzettel Für die angebotenen Reisen sind noch wenige Restplätze verfügbar. Die Verfügbarkeit
restplatzshop.ch
453 Schottland Reise Reisen Nordeuropa

Rundreisen auf den britischen Inseln im Nordwesten von Europa Informationen für Ihre Schottland Reise ... ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder dieser Region finden
schottland-reise.ch Nordeuropa Schottland
454 Golf und Reisen Südafrika Golf

Erleben Sie attraktive und abwechslungsreiche Ausflüge auch für Nicht oder WenigGolferInnen. Geniessen Sie den ... Home Reisen Über uns Kontakt Golfen ist nicht alles... es ist viel mehr Golf in Südafrika
golfreisen-suedafrika.ch Golf Golfreisen Golfreise Südafrika Garden Route Sport Abenteuer
455 Bürki Reisen Bäriswil Bus
3323
Bäriswil
Das B#252;rki Reiseunternehmen bietet vielseitiges Carreisen Badeferien und St#228;dtereisen (Weihnachtsmarkt). Gut ausgestattete Cars ab ... Slowenien Willkommen bei Bürki Reisen Wie in den vergangenen Jahren haben wir Ihnen auch in unserem
buerki-reisen.ch Bus Busreisen Reisen Carreisen Car
456 Argentinien Reisen individuell Argentinien

Argentinien ein trendiges Reiseziel. Nicht zu unrecht denn Argentinien wird auch das Land
argentinien-reisen.ch Argentinien Reisen Individual Reisen
457 Auf den Wegen von Tauchen

fahrwasser reisen und tauchen ... -Kathmandu Kathmandu Startseite Aktuell Tauchen Reisen "Kleine Ferien" Fasnacht Projekt Links Gästebuch
fahrwasser.ch Tauchen Reisen Landrover Citroen Fotografie Projekt04 Wandern Unterwasser
458 ReiseMeister.ch Thailand

Reisen Flüge Mietwagen ... Empfehlungen für Pauschalreisen ... ¤ Sonstige Links ... Billig-Reisen Billigurlaub Billigflug Schnäppchen
reisemeister.ch Thailand Last Minute BilligReisen Billigurlaub
459 Peru Reise Reisen Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Peru Reise ... Was empfiehlt der Spezialist für meine Reise ? Bilder dieser Region finden Sie in unserem Fotoalbum - Peru
peru-reisen.ch Südamerika Peru Anden
460 Namibiareisen.ch Individuelle Reisen Namibia Individual Travel GmbH individuelle
8123
Ebmatingen
NamibiaReisen ist ein auf Wüstentouren und indiviuelles Trekking spezialisiertes Unternehmen in der Schweiz. Unsere Partner
namibia-reisen.ch Individuelle Touren Begleitete Safaritouren Wüste Hotels
461 Giacomina und Walter`s HP Wohnmobil

Giacomina und Walter`s womos und Reisen ... Baica Hera Hope Reisen Westküste Griechenland Auf dem Landweg nach Griechenland Bilder Galerie
giva.ch Wohnmobil Reisen Griechenland Italien Deutschland Hunde Hundefutter Tiernahrung
462 Schweizer Touristik Fachmagazin fachmagazin

Homepage des Magazins 'Schweizer Touristik' dem Fachmagazin der Schweizer Reise und Touristikbranche mit taeglich
schweizertouristik.ch Fachmagazin Schweiz Swiss Schweizer
463 Finland Fantasy GmbH: Hütten Lappland Hütten

Finland Fantasy GmbH: Hütten Lappland Luxusschiff Reise Reiseanbieter Finnland Blockhausferien Eisangeln
midimoulin.ch Hütten Lappland Luxusschiff Reise Reiseanbieter Finnland
464 Venezuela Reise Reisen Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Venezuela Reise ... und darum sind für eine Reise offizielle Warnungen und Empfehlungen zu beachten. Das Klima das Landes
venezuela-reisen.ch Südamerika Venezuela Anden
465 Grossbritannien Reise Reisen NordEuropa

Rundreisen auf den britischen Inseln im Nordwesten von Europa Informationen für Ihre Grossbritannien Reise ... eine Reise nach Cardiff? Wir verraten Ihnen was Sie unbedingt anschauen - oder anstellen sollten. Etwa
grossbritannien-reisen.ch NordEuropa Vereinigtes Königreich Von Grossbritannien Grossbritannien
466 Reisen Meister Carreisen
3600
Thun
Reisen von Meister Carreisen Thun. Tagesreisen und Theaterbesuche in der Schweiz Rundreisen in der ... Reisen Dienst-leistungen Team Firma Chronik Kontakt Reisen Jedes Jahr stellen wir neben
meister-reisen.ch
467 England Reise Reisen Nordeuropa

Rundreisen auf den britischen Inseln im Nordwesten von Europa Informationen für Ihre England Reise ... ich diese Region am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder
england-reise.ch Nordeuropa England
468 Reisen

... flashpacker Reisen Vulkane Fliegen Fotografie Kotztueten Ueber mich fredy thürig
thuerig.ch
469 Christoph Hammer Fotografie Fotografie

Fotografie und Reisen Fotografien aus aller Welt ... ÜBER MICH AKTUELL REPORTAGEN REISEN LÄNDER LANDSCHAFTEN Kulturen Menschen Gesichter SITEMAP THEY DIG WITH THEIR
christophhammer-photography.ch Fotografie Photography Fotos Bilder
470 Grönland Reise Reisen Kanada

Rundreisen in den Regionen im Hohen Norden von Europa Informationen für Ihre Grönland Reise ... als Reiseziel? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder dieser Region
groenland-reise.ch Kanada Canada USA America
471 Frankreich Reise Reisen Frankreich

Rundreisen in den Regionen im Westen von Europa Informationen für Ihre Frankreich Reise ... -Provence Südfrankreich - Aus reinem Interesse. Wie muss gute Seife duften? Eine Reise in die sauberste
frankreich-reise.ch Frankreich Europa
472 Brasilien Reise Reisen Südamerika

Rundreisen in der Region des Amazonas im Osten von Südamerika Informationen für Ihre Brasilien ... und war verrufen. Jetzt ist das Viertel Pelourinho plötzlich hip - und lohnt eine Reise. Vorgestellt von Spiegel
brasilien-reise.ch Südamerika Brasilien
473 Reisen nach Südamerika Santana Travel GmbH Reise
82362
Weilheim
Urlaub Ferien und Erlebnisreisen Bolivien Rundreisen Länderkombinationen und Reisebausteine für alle Länder ... - Weilheim Service- CH Service- CH Reisen
santanatravel.ch Reise Reisen Fernreise Ferien
474 Email Schmuck Hämatit Email
8055
Zürich
China Trade für Email Emaille Schmuck Email Ohrringe Cloisonné Hämatit
ctaah.ch Email Ohrringe Cloisonne Schmuck Emaille Schmuck
475 Carrreisen Busreisen Busreisen

Car Reisecar Busreise Busreisen Carreisen Gruppenreisen Gruppenreise Hochzeitsreisen ... Heinz Frei-Reisen Übersicht Reise Ziele Gruppenreisen Über uns Unser Reisebus Service
frei-reisen.ch Busreisen Carreise Carreisen Gruppenreisen Gruppenreise Reisebus Pauschalreisen
476 Meine Reisen

... Homepage hat mich dazu bewogen einige weitere Reisen kurz zu dokumentieren. Allerdings ist nur der Bericht
weihnachtsopen.ch
477 Baltikum Reise Reisen Nordeuropa

Rundreisen in den baltischen Regionen im Osten von Europa Informationen für Ihre Baltikum Reise ... der Kreuze und Druskininkai. Einblicke im Reise-Blog von Viator Travel Autor Viator Travel - Bearbeitet
baltikum-reise.ch Nordeuropa Baltische Staaten Baltikum
478 REISEN

... Sie sucht sie Wir suchen euch MAMIS SUCHEN MAMIS REISEN Partnersuche sicheres "Daten" Er sucht sie Region
mixandmatch.ch
479 Holland Reise Reisen Nordeuropa

Rundreisen in den Regionen im Westen von Europa Informationen für Ihre Holland Niederlande Reise ... ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder dieser Region finden
holland-reisen.ch Nordeuropa Holland Niederlande Amsterdam
480 FUNICAR · 2502 BIEL/BIENNE Kontakt zu FUNICAR REISEN AG Funicar
2501
Biel
FUNCIAR das sympathische Reise und Transportunternehmen in Biel. ... Deutsch Français Sitemap Partner unsere Reise-Partner Linienverkehrs-Partner unsere Transporte
funicar.ch Funicar Reisen Carreisen Kleinbusvermietung
481 Schweden Reise Reisen Nordeuropa

Rundreisen in den skandinavischen Regionen im Norden von Europa Informationen für Ihre Schweden Reise ... Empfehlung Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder dieser Region finden
schweden-reisen.ch Nordeuropa Schweden
482 Creahitshoponlineshop Thek Thek

Thek Etui Bastel Jemako Gonis Walde Reisen Schiessen Schuetzenverein
waldesg.ch Thek Etui Bastel Jemako
483 Beringerreisen Taxi Beringer

BeringerReisen. Thayngen Schaffhausen Taxi Kleinbus Car Flughafentranfer
beringer-reisen.ch Beringer Reisen Taxi Kleinbus
484 Herzlich Willkommen bei Adventours Reisen
3145
Niederscherli
Reisen Marroko Schweden Skii Doo Rumänien ... auch Individuell auf Anfrage Main Menu Home Reisen Tourangebote Outside Fun Garage Fotogallerie Über Adventours
adventours.ch Reisen Marroko Schweden Skii Doo
485 Primafila Reisen Die prima

Prima Fila die Schweiz ganz nah erleben ... /httpdocs/typo/sysext/cms/tslib/class.tslibfe.php on line Primafila Reisen - Die Schweiz ganz nah
primafila-reisen.ch Prima Fila Reisen Schweiz Nah Erleben
486 Taxi Flughafen Taxi Zürich Zürichflughafen

Rollsthl Städtli Taxi Wäckerlin fährt sie zum Flughafen Zürich Bern Basel zum Airport ... Taxi Renault Vel Satis Ford Transit mit Rollstuhl einrichtung Reise Bus und Alufährboote Diessenhofen
staedtli-taxi.ch Zürichflughafen Taxi Bus Kleinbus Kurierdienst SH Flughafentranster Bahnhof
487 Reisefuedlis.ch Home Reisen

Träume nicht dein Leben lebe deinen Traum! Reisen oder Ferien? Wir Reisen lieber! ... die coolste Stadt Tage Flüge Auto... jaja wir spinnen. Diese Reise war was ganz Spezielles
reisefuedlis.ch Reisen Wandern Alpen Foto
488 Kurzreisentraveltipp Sprachreisen

traveltipps Ferien ReiseInformation und online Buchung für Kurzreisen Hotels und Ferienwohnungen Bahnreisen und Mietautos ... +++ unabhängiges Reiseportal - Reisen günstiger und schnell direkt bei den Reiseveranstalter online
travel-tipp.ch Sprachreisen Reisen Reiseinformationen Reiseinformation Reiseinformation Reisein
489 Dorado Latin Tours ist

Planen Sie Ihre nächste Südamerika Costa Rica Reise mit Dorado Latin Tours. Ihr Wunsch ... Reise-Spezialisten Reisenews Reiseberichte Costa Rica Die Schweiz Mittelamerikas Argentinien Land
dorado.ch
490 Finnland und Lappland Reisen

Finnland und Lappland Reisen vom Spezialisten Finnland Reise Lappland Reisen Finnland Urlaub ... Kulinarischer Genuss Lapplands Familienreisen Reisen für Paare Für Alleinreisende Schnupperreisen
finntours.ch
491 Auto Reisen Auto

Auto Wohnung Reisen Games Kontaktanzeigen Party Kalender Last Travel
portal111.ch Auto Wohnung Reisen Games
492 HOME Spenden: Project-Starfish GmbH Reisen
8820
Wädenswil
ProjectStarfish. Unter Segeln Reisen Meer erleben ... KURSEGALERIEKONTAKT? LOGIN? ? links HOME BLOG PROJEKT Philosophie Projektdaten Starfish Crew REISEN
project-starfish.ch Reisen Meer Segeln Project
493 Reisener.ch Squash philipp
21337
Lüneburg
Hier informiert Sie Squashfan Philipp Reisener ueber die ActionSportart Squash ... sehr zu empfehlen. Hier finden Sie Informationen von Philipp Reisener zum Thema Squash
reisener.ch Philipp Reisener Squash Squash Sport
494 Home Chris

Chris Iseli Fotografie mit Schwerpunkt Presse Reportage und Reisen. ... in der Stadt zu bleiben. Mehr über unsere Reise auch auf unserem Blog www.rundumplum.wordpress Folge
buenosdias.ch Chris; Iseli; Christian; Foto; Fotografie; Lenzburg; Presse; Reportage
495 Startseite urechnews

Urechnews bietet Weisheiten Bilder von Reisen und Fotoprojekte ... Ruth und Hansruedi Suchen ... Startseite Weisheiten Fotoprojekte Reisen Augenblick mal keine Zeit
urechnews.ch Urechnews Weisheiten Namibia Bilder Myanmar
496 Carreisen | Busreisen | Knöpfel Reisen GmbH Startseite
8474
Dinhard
Herzlich Willkommen bei Knöpfel Reisen! Ihr Car und Busunternehmen aus der Region Winterthur. Spezialist für ... Navigation überspringen Kontakt Suchen Sitemap Navigation überspringen Startseite Reisen Winter
knoepfel-reisen.ch Startseite | Carreisen | Rundreisen | Tagesfahrten |
497 Lastminute Badeferien

Günstig in die Ferien mit Angeboten fuer Lastminute Badeferien Pauschalreisen Hotel und ... und entdecken Sie die Urlaubsvielfalt von Neckermann Reisen. Traumferien günstig auf neckermann-reisen buchen
neckermannreisen.ch
498 Reisebüro webook.ch für ihre Online

Ihr Reisebüro webook.ch mit persönlicher und kostenloser Beratung für Ihre Ferien. Zu Internetpreisen aber ... Reisebüro Webook Home Reisen Rundreise Kreuzfahrten Individualreisen Familienferien Aktivferien
50plus-ferien.ch Online Reisebüro Webook.ch Online Schweiz
499 Ruedi Giger Waermetechnik Indien

Indien Reise
modernheizen.ch Indien Reise Zug
500 HarleyTour 2010 USA

USA Reise
thoems.ch USA Reise Harley Tour
501 Wirkungsvolle CD bei unerfülltem Kinderwunsch

Bei Kinderwunsch Entspannungs Reisen in mp3 erhöhen Sie Ihre Chancen um nicht mehr ungewollt ... -Freivogel Kriens - + Illustration mit einem nackten Pärchen Kinderwunsch Reisen
kinderwunsch-buch.ch Kinderwunsch Wirkungsvolle Entspannungs Reisen Audiodateien
502 Willkommen bei jeepdesign.ch dem offroad

Jeepdesign Offroad Travel Reisen Schweiz ... Home Offroad-Reise AGB Bildergalerie Kontakt Firma Gästebuch Link
jeepdesign.ch Offroad Reisen Offroad Travel
503 Absolut Tennis : Tennishotels Tennishotels

Absolut Tennis Tennishotels Tennisreisen Tennisurlaub Tenniszubehör Tennis Ferien Tennis
absolut-tennis.ch Tennishotels Tennisreisen Tennisurlaub Tenniszubehör
504 Herzlich willkommen bei Mediteran Mediteran Travel GmbH Reisen
8002
Zürich
Mediteran Travel Zürich Schweiz Reisen für Menschen mit Behinderung ... Reisen für Menschen mit Handicap Home Herzlich willkommen bei Mediteran Travel Reisebegleitung
mediteran-travel.ch Reisen Medizinische Pflege Medizinische Reisebegleitung
505 HolidayDealer Negara AG Reise
8280
Kreuzlingen
Die ReiseSchnäppchen Seite mit den absoluten TopAngeboten! Unsere Mission ist es für Euch die ... für die Reise Holiday-Dealer Die besten Reise Deals Reise Inspirationen ! Home Aktuelle Angebote Reise
holiday-dealer.ch Reise Ferien Reiseschnäppchen Blog
506 Unbenannte Seite Camping RKReisen

Reisen mit dem Wohnmobil in ferne Länder
kurtkuenzler.ch Camping RKReisen Reisen
507 Günstige Flüge Belgrad | Perimex AG
4002
Basel
Miro Reisen bietet Ihnen schon seit über zwanzig Jahren erfolgreich Flüge in die ganze Welt ... Reisen Perimex AG Solothurnerstr. CH- Basel Schweiz Unsere Leistungen Flugtickets Badeferien
miro-reisen.ch
508 Ihr Reisebüro für Last albanien

Das Reisebüro für Last Minute Reisen nach Kroatien | Hotels Flüge Billigflüge
albanien-travel.ch Albanien Albanien Tourismus Albanien Urlaub
509 Wuesten reise

Wuesten reise pic livejasmin. Online orgasm webcam ?
wuesten-reise.ch
510 Südstaaten Reise Reisen USA

Rundreisen in den Südstaaten im Südosten der USA Informationen für Ihre SüdstaatenUSA Reise ... und gleichzeitig auch eine moderne Reise Destination mit vielen Sehenswürdigkeiten. Der westliche Teil
suedstaaten-reisen.ch USA America Amerika Nordamerika
511 Luxus Kreuzfahrten vom Experten kreuzfahrten
78462
Konstanz
Persönliche Beratung und bester Service durch jahrzehntelange Erfahrung beim Reisebüro Ticket Shop. ... sondern um zu reisen? J. W. von Goethe Weltreisen Only first class cruises Startseite Specials
luxus-kreuzfahrten.ch Kreuzfahrten Kreuzfahrtschiff Luxus Flussreisen Schiffsreisen Reisen Schiffe Des
512 Viacello.ch Das einzigartige

Viacello Einzigartiges Reise und Übungscello
viacello.ch
513 Tina Hansen Sprachen Englisch

Tina Hansen Sprachen und Reisen
tinahansen.ch Englisch Für Erwachsene Einzel Und Gruppenunterricht Seniorenkurse
514 Mitteleuropa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Mitteleuropa
mittel-europa.ch Europa Nordosteuropa Westeuropa Südosteuropa Mitteleuropa Tschechien Polen Slowa
515 Tauch Reise Veranstalter Unter WeDive Travel AG Reiseveranstalter
8105
Regensdorf-Watt
Ihr Tauch Reise Veranstalter zu den sch?nsten Tauchzielen der Welt. Ausf?hrliche Info ?ber den Unter ... Kundendaten Reise-Feedback Logbuch Presseberichte Über uns Unser Team Unser Konzept Reisebedingungen
wedive.ch Reiseveranstalter Schweiz Regensdorf Z?rich
516 Ruth Steinmann Feldenkrais Ruth

Diese Seiten Informieren über Ruth Steinmann ihre Feldenkrais Kurse Malkurse Kulturreisen ... Ruth B B Feldenkrais Malen Reisen Buch Kontakt Willkommen bei Ruth Steinmann. Auf diesen Seiten
ruthsteinmann.ch Ruth Steinmann Kurs Kurse Feldenkrais Feldenkreis Malen Malkurs
517 Reisen vergleichen und preiswert urlaub

... Jetzt Ihre Reise buchen und CHF Reisegutschein sichern! Frühbucherreisen Lastminute
ab-ins-blaue.ch Urlaub Frühbucherreisen Pauschalreisen Reisen
518 JustiGo.ch | Hotels für

JustiGo.ch Hotels für Reisen Hotel Reservierung Buchung Deutschland Österreich Frankreich Schweiz Italien Spanien Großbritannien Vereinigtes ... Barcelona Hotels JustiGo - Hotels für Reisen Hotel Reservierung Buchung -
justigo.ch
519 Nepal Tibet Nepal

Wir bieten Kulturreisen und Trekking in Kleingruppen oder individuell. Ganz besondere Programme für Nepal
nepal-reisen-trekking.ch Nepal Reise Trekking Kathmandu
520 Ferien Trekking in Ferien
4450
Sissach
über 370 attraktive Trekking und FerienZiele in der Schweiz unübertroffen mit klickbaren Plänen ... Zentralschweiz Ostschweiz Graubünden Engadin Tessin Region Lugano Sehenswürdigkeiten Ferien Schweiz Film Reise
myswisstrek.ch Ferien Schweiz Trekking Reise
521 Startseite Bhutan
85368
Moosburg
Bhutan Travel alles was Sie für ihre erfolgreiche Reise in den Bhutan brauchen! ... Huber in den Nationaltrachten der Bhutaner "Die Kira für die Frau und der Go für den Mann" beim Reise
bhutantravel.ch Bhutan Travel Reise Reisen Asien Bangkok Thailand Königreich
522 Uncle Ben's Uncle

Uncle Bens's Rezepte rund um Reis Tipps zur bewussten Ernährung Gewinnspiele und ... Produkte Uncle Ben?s® Qualität Parboiled-Verfahren Spitzen-Langkorn-Reis Reis-Spezialitäten Risotto Express
unclebens.ch Uncle Bens Reis Bewusst Ernährung
523 Reisebüro Carreisen Reisebüro
4513
Langendorf
Ob Rundreisen Städtereisen Eventreisen Badeferien Welnessferien Kreuzfahren Veloreisen ... Öffnungszeiten Über uns Reiseteam Chauffeure Filiale Grenchen Freie Stellen Schneider Transporte Schneider Reisen
carreise.ch Reisebüro Carreisen Rundreisen Städtereisen
524 Oeti's Internet Island Ferien
5630
Muri
oii Das werbefreie Portal über Reisen Freizeit Unterhaltung... und mehr! ... Home Reisen Ausflüge Länder Berichte Informationen Kurzinfos Fotos Anderes Apps oe WallBillCount
oii.ch Ferien Reisen Länder Fliegen
525 ????? Deluxe Reisen weltweit
78462
Konstanz am Bodensee
Reisen ????? zum Sparpreis ?PAUSCHALREISEN ?LASTMINUTE ?PREISVERGLEICH ? 07531 65870 ? +41 525 110375. ... Ihrer Buchung Premium Reisen mit Bestpreis Garantie - seit MALEDIVEN BORA BORA SÜDSEE SEGELKREUZFAHRT CUBA
reisen-deluxe.ch
526 Amigos Tours by Viajes Spanien

Spanien uns kommt nix spanish vor Madrid Barcelona Mietauto in Spanien
amigostours.ch Spanien Uns Kommt Nix Spanish Vor Madrid Barcelona
527 Reisen nach Iran

Geführte Reisen ab der Schweiz mit erfahrenen Reiseleitern. Zusätzlich bieten wir BusinessReisen mit Möglichkeiten gezielte
irantours.ch
528 EVR Events und VIP

EVR Events und VIP Reisen in Köln zeichnet sich besonders durch die Kombination als Incentive ... -Balance » Incoming Kunden der EVR » Unsere Kunden » Referenzen Kontakt zu EVR Events + VIP Reisen GmbH
evr.ch
529 Westeuropa Tourismus Reisen europa

Informationen über Destinationen Tourismus Reisen und Kultur in den Regionen in Westeuropa
west-europa.ch Europa Westeuropa Alpenländer Alpen Gebirge Berge Belgien Deutschland
530 Botswana Reisen | Botswana

Botswana Reise und Botswana Safaris. Luxus Lodges und Camps in atemberaubender Natur entdecken Sie ... ¶hepunkte Reiseinfos Safaris und Reisen in Botswana Wir organisieren für Sie Safaris und Reisen in Botswana
botswana-reise.ch
531 Südsee Ferien Ozeanien

Pacific Pearls Travel ist ihr PazifikSpezialist in der Schweiz. Wir stellen unvergessliche Reisen in die ... . Da wir ? als Generalvertretung von Pacific Travel House in München ? unsere Reisen über Deutschland buchen profitieren
pacific-pearls.ch
532 Ost USA Reise USA

Rundreisen in den Staaten im Nordosten der USA Informationen für Ihre OstUSA Reise ... für meine Ost USA Reise ? Bilder dieser Region finden Sie in unserem Fotoalbum - Ost USA Und Vorschläge
ostusa-reisen.ch USA America Amerika Nordamerika
533 Nepalreisen Trekking und Kulturreisen Trekking
76275
Ettlingen
Nepalreisen Trekking und Kulturreisen in kleinen Gruppen und Individualreisen Reisetipps und Landesinformationen zu Nepal ... . August € Kontaktmöglichkeiten für Reise und Trekking Gästebuch von Nepalreisen
nepalreisen.ch Trekking Reise Reisen Nepal
534 Für Sie unterwegs Albisser

Albisser Reisen Car Bus Tagesausfluege Ferienreisen Gruppenreisen Gesellschaftsreisen ... Partner Suche Prev Next Reisen Ferienfahrten Tagesfahrten Theater Konzerte ... und mehr
albisser.ch Albisser Reisen Car Bus Tagesausfluege
535 SUN CLUB Reisen AG

Sun Club Reisen AG FKKFerien Das Schweizer Reisebüro für FKKFerien am Mittelmeer auf den ... Village ?? SUN CLUB Sunshine Reisen - Wilerstrasse - Flawil - + -
sunclub-reisen.ch
536 Uschterreisen.ch uschterreisen

Uschter Reisen Zürichstrasse 1 8610 Uster Telefon 044 905 60 50 ... Wettbewerb Pluspunkte Uschter Reisen Team ? Adresse Anfahrtsplan Bereiste Länder Japan Strand- Wüsten
uschter-reisen.ch Uschterreisen Uschter Reisen Uster Reisen
537 Www.bojanreisen.ch reisen

Bojan Bus Reisen Müllackerstrasse 31 8152 Glattbrugg ... Home Car-Reisen Bildergalerie Referenzen Kontakt Main Menu Home Car-Reisen Bildergalerie Referenzen
bojanreisen.ch Reisen Carfahrten Ferienreisen Ferien
538 Reisen nach Brasilien Südamerika

Brasilien fasziniert: die spannendsten Reiseziele des südamerikanischen Landes ... Spezialist für Brasilien-Reisen Sitemap Kontakt Sprache Deutsch English Reise-Angebote Brasilien
adventurebrasilien.ch Südamerika Brasilien Reiseziel Rio De Janerio Sao
539 Denier Photography www.photostream.ch Reisen

Virtuelle Reise durch Afrika und Online Shop für Fotoprodukte. ... können Sie in der Bildergalerie eine virtuelle Reise durch Afrika starten - viel Vergnügen mit den Fotos! Afrika News Nach Namibia
photostream.ch Reisen Reiseberichte Bildergalerie Botswana Namibia Tierwelt Afrika Kalender
540 [Madagaskar Madagascar] Madagaskarhaus

Im Madagaskarhaus finden Sie alle Infos zu Kultur Natur und Reisen in Madagaskar. ... über Madagaskar > Land und Leute > Natur und Kultur > Infos zu Reisen > Reisevorschläge > Flüge ab Europa
afrika-haus.ch Madagaskarhaus Afrika Africa Madagaskar
541 Türkeireisen.ch Türkei
8902
Urdorf
Türkei Rundreisen Blaue Reisen Istanbul und Türkei individuell ... Osttürkei-Rundreise TR - Westanatolien TR - Türkei Wander - Reise TR - Höhepunkte Kappadokien TR
xn--trkei-reisen-dlb.ch Türkei Rundreisen Istanbul Bursa
542 Engel Reisen : Flüge Lastminute

Engel Reisen das Online Reisebüro in Chur. Flugtickets Lastminute Badeferien Flüge ... Minute Kreuzfahrten Gruppenreisen ENGEL REISEN CHUR Gäuggelistrasse CH- Chur T +
engelreisen.ch Lastminute Badeferien Flüge Hotels
543 China Tibet Tours Asien

Chinesischer Reiseveranstalter organisiert ChinaReisen Urlaub in China besondere China Reisen:Rundreisen Expeditionen Trekkingund Abenteuerreisen in China ... Individual Reisen Gruppen Reisen Erlebnisreisen Tibet Nepal Kontakt Service Suchen Lernen Sie China kennen
repvalue.ch Asien China Gruppenreisen China Individualreisen China Reise Experte
544 Willkommen bei Botanikreisen botanik

Wanderungen durch die bunten Blumenteppiche am Kap der Guten Hoffnung Entdecken der ungewöhnlichen Endemiten ... Sizilien »Angebot »Aktuelles Pro­gramm »Vergangene Reisen »Über uns »Teilnahme Willkommen
botanikreisen.ch Botanik Reisen Pflanzen Ferien
545 Ryffel AG Ihr

Bereits in der 4. Generation von Familie Ryffel geführt ist die Ryffel AG mit Sitz ... bewegt Ryffel Menschen ? als Spezialist für Reisen und Transporte. Ryffel History Jetzt ansehen Reisebüro
ryffelag.ch
546 Carreise Carunternehmen Carfahrt Europapark carreise

BornReisen AG Olten Wir sind das ProfiCarunternehmen bezüglich Carreisen Europapark Rust ... Carofferte Carunternehmen Reisecars Öffnungszeiten Born Reisen-Team Firmengeschichte Herzlich Willkommen
europaparkbus.ch Carreise Carreisen Carfahrt Carfahrten
547 Bolivien Peru Reise Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Bolivien Peru ... ich diese südamerikanische Region am einfachsten ? Thema Empfehlung Was empfiehlt der Spezialist für meine Reise ? Bilder
bolivienperu-reisen.ch Südamerika Bolivien Peru Anden
548 Grira Travel Agency : Tunesien

Ferien in Tunesien Ihr Online Reisebüro LastMinute Angebote Grenzloses abenteuer mit
grira-travel-agency.ch Tunesien Ferien Douz Reisen
549 Rum3ber Home Rumtreiber

Die Seite für Rumtreiber von Martina Gerisch und Ralf Hersel. Reisen Sport Design ... Ansichtssuche Navigation Home Events Design Wir Reisen Sport Projekte Galerie Kontakt Suchen Suchen
rum3ber.ch Rumtreiber Rum3ber Reisen Sport
550 Reisebüro FLUGREISE Die Flugreise

Im Reisebüro FLUGREISE Urlaub und Fluege suchen anfragen und buchen als auch Pauschalreisen ... Unterkunft Mietwagen Reiseideen Könnt Ihr mir helfen NurFlug Anfrage Pauschalreise Anfrage Reise-Informations
reisebuero-traumreisen.ch Flugreise Deinurlaub Efly Flug
551 Florida Bahamas Reise USA

Rundreisen in Florida im Südosten der USA Informationen für Ihre Florida Reise US ... für meine Reise ? Bilder dieser Region finden Sie in unserem Fotoalbum - Florida und Fotoalbum - Bahamas
floridabahamas-reisen.ch USA America Amerika Nordamerika
552 Reisen einmal anders gruppenreisen

rolf gisler tours einfach anders reisen
delfinbus.ch Gruppenreisen Einzelreisen Reisearangements Reiseunternehmen
553 Www.servzh.ch * Schweizerischer EisenbahnerReiseVerein serv

... Rund um Fahrpläne Allgemeines Brauchtum CH serv-zh Schweizerischer Eisenbahner-Reise-Verein Sektion
serv-zh.ch Serv Servzh SBB Reisen Geselligkeit Wandern öV Eisenbahnerverein
554 Herr Thomas Meyer Thomas

Thomas Meyer ist ein Schweizer Schriftsteller (»Wolkenbruchs wunderliche Reise in die Arme einer Schickse«). ... wunderliche Reise« Villa Grunholzer Florastr. CH- Uster Freitag . April . Uhr »Wolkenbruchs
thomasmeyer.ch Thomas Meyer Autor Schriftsteller Wolkenbruchs
555 Ecuador Galapagos Reise Südamerika

Rundreisen in der Anden Region im Westen von Südamerika Informationen für Ihre Ecuador und ... Gebiete des Landes sind so unterschiedlich dass die Reise durch Ecuador und die Galapagos-Inseln immer
ecuadorgalapagos-reisen.ch Südamerika Ecuador Galapagos Anden
556 Flug weltweit online buchen Flug

Flug online buchen Günstige Flüge Billig fliegen Flugreisen zu Spitzenpreisen. Bequem und
flug.ch Flug Flüge Flug Buchen Flug Reservieren Günstiger Flug
557 Wüstenfeuer Trekking Reisen Trekking
4802
Strengelbach
Möchtest du in Kleingruppen oder Individuell die Faszination der tunesischen Sandwüste erleben? Dann tauch ein ... Impressionen Brigitte und Bruno- .. Die Weltnachrichten verunsichern zur Zeit es scheint dass Reisen
wuestenfeuer.ch Trekking Tunesien Wüstenreise Reise
558 Seelentrost für verletzte Seelen seelentrost

Seelentrost Iris Neumeier die Therapie verändern ein Trauma auf Reisen der Seele ... aus der Vergangenheit wie die Kindheit und traumatische Erlebnisse heilen geführte Reisen Problemen begegnen
seelentrost.ch Seelentrost Seele Neumeier Iris
559 Deutschland Reise südliche Deutschland

Rundreisen in den Regionen im Westen von Europa Informationen für Ihre Deutschland Reise ... Flussreise Basel Köln Reise auf dem Rhein. Mit dem Schiff zum Kölner Dom. Wer ein liebliches Stück
sueddeutschland-reisen.ch Deutschland
560 Uganda Reisen | Uganda

Uganda Reisen und Uganda Safaris. Erleben Sie nebst dem Gorilla Trekking im Bwindi Impenetrable Forest ... SwissAfrican Destinationen Erlebnisse Reisen Uganda Unterkünfte Reisebeispiele Insidertipp HÃ
uganda-reisen.ch
561 In REISENTOUREN finden Sie FerienVorschläge

Das Reiseportal ReisenTouren.de wurde im 2001 von Riccardo Rausch gegründet. Durch Vorschläge und Anregungen konnten ... Freitag . Dezember Home Reise Reports Leserberichte News Bericht Eingeben Suchen
reisen-touren.ch FerienVorschläge Urlaubstipps Hotel Empfehlungen Unterkünfte
562 Deutschland Reise nördliche Deutschland

Rundreisen in den Regionen im Westen von Europa Informationen für Ihre Deutschland Reise ... Was empfiehlt der Spezialist für meine Reise ? Ein paar Bilder dieser Region finden Sie in unserem Fotoalbum
norddeutschland-reisen.ch Deutschland Berlin Hamburg Bremen
563 Urlaub buchen | König König Reisen AG
4153
Reinach
Sie möchten einen Urlaub buchen? Wir haben das perfekte Angebot für eine Kreuzfahrt auf Schiffen ... Kontakt König Reisen AG - Wir setzen Ihren Ferien die Krone auf. Thailand Sala Phuket Resort Spa pro
koenigreisen.ch
564 Home Travel Clinic

Die Travel Clinic Zürich ist eine auf Reise und Tropenmedizin spezialsierte Arztpraxis in Zürich. Sie ... steigen. Schützen Sie sich so gut wie möglich vor Mückenstichen und reisen Sie möglichst
travelclinic.ch
565 Dr. Hans Reiser Arrest
8053
Zürich
... Sie mit mir Kontakt auf... RA DR. IUR. HANS REISER BUCHHOLZSTRASSE POSTFACH CH- ZÜRICH INFOREISER-RECHT.CH
reiser-recht.ch Arrest Aktienrecht Ansprüche Anwalt
566 Lastminute Ferien Mastichari

Lastminute Ferien Mastichari Kos Reisen Griechenland und mallorca hotel casa marina bay samana ... CH-Datenbank mit den aktuellen Last Minute Reisen und Sonderangeboten der grossen Schweizer
gutereisen.ch
567 Last Minute Reisen Last

Sparfüchse kommen im Internet auf ihre Kosten. Je flexibler man ist desto grösser ist die ... www.last-minutes Werbung www.reisehit - Tagesaktuell Last Minute Reisen im Preisvergleich
last-minutes.ch Last Minutes Reisen Last Minute Reisebüros Reiseportale Lastminute
568 Herzlich willkommen bei Beatrix Reisebüro

by Beatrix Travel AG ... ? Haben Sie den richtigen Reise-Standard gewählt? Sind Motorhome Ferien das Richtige für Sie? Sind Mietwagenrundreisen
beatrix-travel.ch Reisebüro Rapperswil Reisen Reise
569 Die spannendste Reise ist FussreflexzonenMa

Man kann sein Leben weder verlängern noch verbreitern nur vertiefen. Dafür ist unser Körper das
koerperreise.ch FussreflexzonenMassage ZenShiatsu Reiki Wirbeltherapie CraniosacralBalancing
570 Schweizer Reise Reisen Schweiz

Rundreisen in der Alpen Region im Westen von Europa Informationen für Ihre Schweiz Reise ... und in den verschiedenen anderen Fotoalben der Schweizer Regionen Und ein Vorschläge für Ihre Reise unter unseren
schweizer-reise.ch Schweiz Europa Alpen
571 Cosmos Tours Home Ferien
3270
Aarberg
Für Reisen rund um den Globus. Zählen Sie auf Knowhow Herzblut und Leidenschaft eines ... Gruppenreisen Incentive Reisen Unsere Welt Airshows Aviatik Anmeldeformular Airshows Viktor Röthlin
cosmostours.ch Ferien Reisen Urlaub Airshows
572 Bentour Türkei Reisen: Ihre Bentour
8004
Zürich
Last Minute in die Türkei? Angebote von Bentour gelten in der Schweiz als das umfassendste ... Familienferien Türkei Rundreisen Blaue Reisen - Schiffsreisen Wander-Ferien BENSWISS®-Qualität à la Carte
bentour.ch Bentour Türkei Reisen Schweiz Ferien Urlaub Golf Flug
573 Www.sealifeonline.ch Home Sealife

Eine Website die sich vor allem mit Tauchen und Unterwasserwelt Reisen und Garten befasst. ... Sea Meerwasser Lexikon Fische Niedere Tiere Korallen Lexikon neu Reisen Kreta Dolomiten
sealife-online.ch Sealife Tauchen Unterwasserwelt Rotes Meer
574 Dresden und more dresden
8302
Kloten
Lassen Sie den Alltag hinter sich und genießen Sie eine spannende Reise nach Dresden. ... hat viel zu bieten. Neben den kulinarischen Köstlichkeiten sorgt die sächsische Weinstraße dafür dass Reisen
dresdenandmore.ch Dresden Besuchen Reise Nach Dresden Dresden
575 Claudia di gallo claudia

Claudia Di Gallo Reisen jenseits des organisierten Systems ... ein multimediales Comeback das die Besucher zu Reisen in spährische Dimensionen einlädt www.digallo. Katalog
digallo.ch Claudia Di Gallo Kunst Neue Medien
576 OutbackJourney Australien

Wir mouml;chten Euch an unserer Reise durch die Weiten Australien's teilhaben lassen und unsere Erlebnisse ... .. Die beste Bildung findet ein gescheiter Mensch auf Reisen. Johann Wolfgang von Goethe ( -
outback-journey.ch Australien Australienreise Reise Reisen
577 Atlantik Kanada Reise Kanada

Rundreisen in den Provinzen an der Atlantikküste von Kanada Informationen für Ihre AtlantikKanada Reise ... sich eine Reise auf jeden Fall lohnt. Die vier kanadischen Provinzen im Osten von Kanadas an der Atlantikküste
atlantikkanada-reisen.ch Kanada Canada USA America
578 Mit Benial Reisen

... Benial Reisen mit Benial Reisen - reisen Sie genial www.benial Package Städtereisen Flüge Hotels
benial.ch
579 Exklusive Reisen weltweit seit Windrose Finest Travel GmbH Windrose
10719
Berlin
Ihr Experte fuuml;r weltweit exklusive Luxusreisen amp; Genussreisen hochwertige Rund amp; Studienreisen mit bekannten ... in kleinen Gruppen Leserreisen In Kooperation mit ZEIT REISEN Harley-Touren Mit Wolfgang Fierek durch die USA
windrosefinesttravel.ch Windrose Reisen Fernreisen Studienreisen
580 Home manger
5708
Birrwil
Manger Reisen das spezielle Fahrerlebnis für Hochzeiten Vereinsausflüge Familientreffs Fahrt ins Blaue ... Nostalgie Postauto Car Reisen Spezialfahrten Transporte Mietfahrzeuge Kontakt/ Login Remember me
manger-reisen.ch Manger Mangerreisen Reise Reisen
581 Asiaspa.ch Informationen zum

asiaspa.ch ist Ihre erste und beste Informationsquelle über Wellness reisen Hier finden Sie auch ... zum Festpreis oder nennen Sie uns unter - Ihren Preisvorschlag. afrika-reise.eu Domain reisen-
asiaspa.ch
582 THALWILER TAXI Taxi

Taxi Bus Reisen
thalwilertaxi.ch Taxi Bus Reisen
583 Liebergleich Urlaub

Günstiger Urlaub Reise
liebergleich.ch Urlaub Reise Flug Mietwagen
584 Www.indianwinter.ch Home Indianwinter

ReiseBlog von Celine Huber
indianwinter.ch Indianwinter Indien Celine Reisen
585 Landolt Individual Travel Experience Landolt

Entdecken Sie Ecuador und Mexico ganz individuell. Mit LITE Tours reisen Sie in Kleinstgruppen und ... Landolt Individual Travel Experience Private Reisen Privat Reisen Privat Tours Private Tours
lite-tours.ch Landolt Individual Travel Experience Private Reisen
586 Touch Asia der OnlineReiseveranstalter AsienReise
9008
St. Gallen
Egal ob Anfänger oder Profi als Familie mit Kleinkindern als Paar oder mit ... haben? Sie sind an einer Asien-Reise interessiert? Egal ob Anfänger oder Profi als Familie mit Kleinkindern als Paar
touch-asia.ch AsienReise Familie Mit Kleinkindern Laos
587 Kurt und Heidi in kurt

alles um unser liebstes Hobby das Reisen im südlichen Afrika ... Reisen durch die Länder im Süden Afrikas haben uns über die Jahre geprägt. So durften wir vielen
kurt-und-heidi.ch Kurt Heidi Schwinn Im Lohgraben
588 Private Site von Seppi Seppi
5728
Gontenschwil
Die private Site von Seppi (Josef) Luthiger enthält Infos über schöne Reisen die Schifffahrt ... ? Startseite ? Familie und Freunde ? Haus Garten Teich ? Fotoalbum ? Reisen ? Modellbahn
luthiger-josef.ch Seppi Josef Luthiger Erna
589 Rundreise laos rundreise rundreise

Spezialist für 3wöchige Abenteuer Rundreisen in Kambodscha Laos. Thailand und Vietnam. Für Individualisten und ... ...Mit uns bist du kein Tourist sondern ein Reisender... HOME RUNDREISEN VIP REISE LAOS
papillontravel.ch Rundreise Laos Rundreise Kambodscha Rundreise Vietnam
590 Unterwex Silvanas Homepage mittelmeer

Urlaub in Frankreich im Südburgund in der burgundischen Bresse. Idyllische Ferien im ... U n t e r w e X Silvanas Homepage - über's Reisen und Gleitschirmfliegen Ferien auf dem Land
unterwex.ch Mittelmeer Südeuropa Europa Wohnmobil
591 Vereinsausflüge Busreisen mit Carreisen

Vereinsausflüge Busreisen mit Carunternehmen Ochsner Reisen Einsiedeln: Carfahrten Carreisen ab Schwyz ... Ochsner Reisen Carreisen Busfahrten Rütiweg CH- Einsiedeln Kontakt VCard Aktuell
ochsner-reisen.ch Carreisen Carfahrten Hochzeitsfahrten Vereinsausflüge
592 Gemeinsam Reisen im Privatflugzeug private

We (based in Switzerland) search companions for travels by private aircraft. ... Travel together by private airplane Voyager ensemble en avion privé Gemeinsam Reisen
zurmuehlen.ch Private Flying Airplane Private Airplane
593 Häseli Reisen Argentinien

Südamerikareisen Häseli Haeseli Reisen haeselireisen Argentinien Bolivien Peru Ekuador Brasilien Paraguay Kolumbien Chile Uruguay Lateinamerikareisen
haeseli-reisen.ch Argentinien Bolivien Peru Ekuador Brasilien Paraguay Kolumbien Chile
594 IHB TRAVEL | Business IHB Travel GmbH IHB
40547
Düsseldorf - Deutschland
Herzlich willkommen bei IHB Travel Ihrem Spezialisten für Geschäftsreisen Hochzeitsreisen und Luxusreisen. Full ... IHB TRAVEL Business Reisen Interaktives Reisebüro Suchen Direkt zum Seiteninhalt HauptmenÃ
ihb-group.ch IHB Travel GmbH IHB Travel Reise
595 Reisebegleiter Reisebegleiter

Sie suchen einen Reisebegleiter für Ihren Urlaub Ihre Ferien eine ... eine Reise Kreuzfahrt Städteausflug Abenteuer oder Wellness? Sehen Sie sich auf diesen Seiten
ihr-reisebegleiter.ch Reisebegleiter Reisepartner Begleitung Reisehilfe
596 Groupon: Deals für Restaurants

Deals mit 5090% Rabatt auf Restaurants Fitness Reisen Shopping Beauty ... Hotels und Reisen Weihnachtsshop Alle Deals Essen Trinken Freizeit Events Beauty Wellness
groupon.ch
597 Webfritz.ch Fritz Kleisli. Fritz

... Home Biography Kontakt Webdesign Werbung Fotografie Reise-Berichte Fotogalerie Kunst Musik Fritz
webfritz.ch Fritz Kleisli Kleisli Consulting Reisen
598 Reisennamibia.ch

... Account reisen-namibia
reisen-namibia.ch
599 PET Security EU 2 and more e.K. Gartensicherung
28816
Stuhr
PET Security EU Sicherheit für Ihr Tier ZaunSysteme zum Schutz von Hund und ... Hinweis für unsere Kunden aus BE LU DK LI AT NL DE FI FR Uk/GB IE IT PT SE CH ES EE CZ
petfence-systems.ch Gartensicherung Katzennetz Katzenzaun Katzengehege
600 Herzlich Willkommen bei ChicuniQ chicuniq
3600
Thun
ChicuniQ steht für schön (Chic) und einmalig (uniQ). Und schön und einmalig möchten wir Sie
chicuniq.ch Chicuniq Schloss Schlösser Burg
601 Alaska ¦ American Football Alaska

Alaska Amerika Honda Reisen Reisefotos Football ... home Reisen Honda CB Football links sitemap kontakt Info und News Die neusten Reisefotos
pethof.ch Alaska Anchorage American Football Chicago
602 ReiseApotheken Wetzikon Reiseberatung

Individuelle ReiseApotheken und kompetente Beratung für weltweite Reiseziele
reise-apotheken.ch Reiseberatung Ferienapotheke Reiseapotheke Impfungen
603 Die fantastische Reise des Russland

Reise quer durch Russland Mongolei Japan Australien
die-fantastische-reise-des-froschs.ch Russland Sibirien Mongolei Kasachstan
604 ReiseApotheken Wetzikon Reiseberatung

Individuelle ReiseApotheken und kompetente Beratung für weltweite Reiseziele
travelpharm.ch Reiseberatung Ferienapotheke Reiseapotheke Impfungen
605 Gabi Hess Reisen ? Gabi

Wanderferien in Griechenland mit Gabi Hess ... Reisen Anmeldung Über Gabi Kontakt Mit mehr als Jahren Reiseerfahrung in Griechenland lasse
gabihessreisen.ch Gabi Hess Reisen Gabi Hess Wandern
606 ULTREIA VERLAG / UELI Ultreia

Ultreia Verlag Vertrieb Bücher Pilgerreisen Referate Jakobsweg Weitwanderliteratur Pilgerliteratur ... ULTREIA VERLAG - Ueli Brunner - ULTREIA REISEN Nachdem ich Jahre lang auf dem Bau als Maurer
ultreiaverlag.ch Ultreia Verlag Bücher Ultreia Ueli
607 Www.bullockie.ch bullockie.ch Bullockie

Reisen in Australien und im südlichen Afrika BremachTRex ... www.bullockie - bullockie Direkt zum Seiteninhalt Hauptmenü × Home Reisen - Travel
bullockie.ch Bullockie Oepfu Bremach TRex
608 Herzlich willkommen bei Travel Travel

TravelPool organisiert Reisen aller Art. ... Home Ferienreisen Geschäftsreisen Portrait News Kontakt Travel-Pool AG Baarerstrasse CH-
travel-pool.ch Travel Pool Lounge Away
609 Switzaland MASSIVE switzaland

switzaland MASSIVE Organisation von Reisen an Events/Festivals in ganz Europa ... Home Events/Reisen Shop Forum Über uns Events/Reisen Wir führen im eine Car Reisen
switzaland-massive.ch Switzaland Massive Switzaland Massive Uaf
610 El travel ? reisebüro einfach
4562
Biberist
Buchen mit el travel ist ganz einfach luxuriös. Das Reisebüro el travel steht für einfaches ... travel team auf entdeckungsreise fotogalerie kontakt öffnungszeiten lageplan Main Menu Eine Reise
eltravel.ch Einfach Luxurioes Reisen Traumreisen Wanderungen Individualreisen
611 NurFlüge.ch Flüge Flüge

NurFlüge.ch Flüge Billigairlines Last Minute Reisen und günstige Reiseangebote auf dem NurFlüge.ch! ... Reise Seiten Hier finden Sie Flüge Billigairlines Hotel Lastminute uvm. Online buchen
xn--nurflge-r2a.ch Flüge Billigairlines Billigairline Linienflüge
612 Kilimanjaro Trekking NepalTrekking Aktivferien AG aktivferien
8472
Seuzach
Aktivferien mit Hansruedi Büchi: Trekking Biking Velo Safari u. andere Abenteuer in ... am Montag . Dezember An diesem Abend wird die ganze Kilimanjaro-Reise besprochen Ausrüstungsliste
surinam.ch Aktivferien Aktiv Ferien Aktiv Urlaub
613 ALSA Dienstleistungen Versicherungen
8610
Uster
Versicherungen Reisen Beratungen Vermittlungen Krankenkasse Sigurime Kredi Udhëtime ... Freitag . Dezember ALSA Diensleistungen GmbH Zürichstrasse CH- Uster
alsa-swiss.ch Versicherungen Reisen Beratungen Vermittlungen
614 Carfahrten Europa Kurferien Kurferien

Carfahrten Europa Kurferien durch Stöcklin Reisen AG Wellnessreisen Busreisen Rundreisen Europa ... Anreise mit Flug nur Fahrt Thermalgärten Kuren Wellness KURZREISEN AUFTRAGSFAHRTEN INFO-REISEN HOME
stoecklin.ch Kurferien Carreisen Italien Carfahrten Europa
615 *****Imperial Reisen der Reisebüro

*****ImperialService ... Imperial Reisen Dienerstr. CH Zürich Telefon
imperial.ch Reisebüro Reisebuero Reisebüros Reisebueros
616 Bruno's Reisen

... Herzlich Willkommen auf der Homepage von Bruno's Reisen
brunosreisen.ch
617 Baumeler Reisen weltweite Wanderferien

Wanderferien und Veloferien weltweit Malferien Bike Stationen ... Unsere Reisen Unsere Reisen Menü schließen Seit organisiert Baumeler Reisen authentische
baumeler.ch Wanderferien Wandern Velo Mountainbike
618 Ferien Dubai Ferien Ferien

Ferien Dubai Ferien Malediven Ferien Mauritius Ferien Seychellen Bischofberger InfoReisen AG ... Bischofberger Reisen Fragen Sie uns Home Unsere Reisen Arabien Orient Abu Dhabi
inforeisen.ch Ferien Dubai Ferien Malediven Ferien Mauritius
619 El travel ? reisebüro einfach
4562
Biberist
Buchen mit el travel ist ganz einfach luxuriös. Das Reisebüro el travel steht für einfaches ... ist ein Buch. Wer nie reist sieht nur eine Seite davon. Aurelius Augustinus Reisen ist das einzig taugliche
einfach-luxurioes.ch Einfach Luxurioes Reisen Traumreisen Wanderungen Individualreisen
620 AfrikaOverland afrika

afrika overland reisen abenteuer südafrika namibia botswana okavango ... Afrika-Overland Home Overland-Reise Wie wird gereist? Reiseroute Bilder Links Kontakt Eine Overland
afrika-overland.ch Afrika Overland Reisen Afrika Overland
621 Südafrika Reisen | Südafrika

Südafrika Reisen und Südafrika Safaris. Verbringen Sie unvergessliche Tage in Kapstadt und auf Safaris im ... SwissAfrican Destinationen Erlebnisse Reisen Südafrika Unterkünfte Reisebeispiele Insidertipp HÃ
suedafrika-reise.ch
622 Gratwandern sozialpädagogischer Lebensraum Erlebnispädagogik

Erlebnispädagogische Angeobte im Bereich Einzelbegleitung und Gruppen. Mögliche Methoden sind Weitwandern Waldleben Schneeschuhtouren ... ¤dagogischer Begleitung und Ansätzen aus der Erlebnispädagogik. Erlebnispädagogische Reisen Einzel
gratwandern.ch Erlebnispädagogik Projekte Erlebnispädagogische Angebote Erlebnispädagogische
623 Reisen Travel Kessler Trogen Reisen

Onlineoffice K Reisen Travel Inseln Familien Appenzellerland South Pacific ... kesslerco Eveline Pius Malolo und Kim Kessler CH- Trogen Appenzeller-Alps Switzerland Internet
clubhaus.ch Reisen Reisen Reisen Travel Travel Travel Kessler Kessler
624 Explore Namibia Reizen namibie

We offer organised selfdrive holidays in Namibia including accommodation. You will drive yourself in a ... gereserveerde accommodaties of op campsites. Wanneer u denkt aan een reis door het Afrikaanse continent dan is
explore-namibia.ch Namibie Namibia Namibie Namibia Reizen Reis Reisen Rondreis
625 Willkommen Lektorat
8802
Kilchberg ZH
Lektorat Gutgesell Ihr Lektorat für Texte aus Wissenschaft Werbung der Welt des ... der Welt des Reisens und der Fantasie Willkommen Über mich Preise Links Kontakt Kennen
lektorat-gutgesell.ch Lektorat Gutgesell Kilchberg Zürich
626 Korndi.ch step by diana

die welt erleben zu fuss und auf dem rad durch neuseeland und australien... ... home reisen fotografie gästebuch links ranja über mich webdesign herzlich willkommen bei korndi's
korndi.ch Diana Korner Korndi Reisen Australia
627 Das Portal fuer Thailand Reiseportal

Hier finden Sie Reisen Fluege und Hotels speziell nach Thailand aber auch ... Ferien Urlaub Rundreisen Reiseportal für Thailand Hotels Reisen Reiseziele Reiseinfos Bücher Shop
thailand-online.ch Reiseportal Fuer Thailand Reiseportal F�r Thailand Reise
628 Die günstigste Reisetarife der reisen

Die günstigste Reisetarife der Schweiz lastminute flüge und hotels ... Die günstigste Reisetarife der Schweiz - Last Minute Ferien und günstige Schnäppchen Reisen
reisetarife.ch Reisen Last Minute Flüge Hotel
629 America On Wheels 4x4

Mieten Leasen oder kaufen Sie bei America On Wheels einen Personenwagen Van oder ... Guatemala Belize El Salvador Honduras Nicaragua Costa Rica Panama Einfach grenzenloses Reisen
americaonwheels.ch 4x4 Geländewagen Camper Van Motorhome Econo Passenger Cars
630 Tansania Reisen | Tansania

Tansania Reisen und Tansania Safaris. Serengeti Ngorongoro Kilimanjaro oder Zanzibar Besuchen Sie ... ¶hepunkte Reiseinfos Safaris und Reisen in Tansania Tansania ist ein unglaublich vielseitiges Land
tansania-reise.ch
631 Startseite Reisen

Reisen Reiseunternehmen Rust Deutschland Italien Spanien Borkum Leer ... JK-REISEN Krohm Jürgen Busreiseunternehmen Schweiz Privatunternehmen Startseite Wettbewerb
jk-reisen.ch Reisen Reiseunternehmen Rust Deutschland Italien
632 CamperWorld Reisen; Spezialist für Campers

CamperWorld Reisen in Lyss wir vermieten Motorhome Camper Mietwagen in Australien ... USA Kanada Australien Neuseeland Reisen weltweit Katalog Specials Preise
camperworld.ch Campers Motorhomes KeaCampers Apollo
633 Dampf Reisen

... Willkommen bei Die Webseite für Ihre Reisen mit Dampf Sie werden gleich weitergeleitet
dampf-reisen.ch
634 Formel 1 Reisen Tickets Formel

Als Partner für Formel 1 Tickets stehen wir für Zuverlässigkeit und einen reibungslosen Ablauf. ... + Unsere Partner Grand Prix - F-Tickets - Paddock - Altstadt Reisen AG Stadtgässli
formel1reisen.ch Formel 1 Tickets 2013 F1Reisen Tickets
635 ITS Coop Travel: Ferien Coop-ITS-Travel AG ITS
8604
Volketswil
ITS Coop Travel: Ihr Reisebüro für Badeferien Last Minute Städtereisen Rundreisen und ... Service Hier finden Sie viele nützliche Informationen zu Themen vor während und nach der Reise
itscoop.ch ITS Coop Travel Badeferien Last Minute
636 Zauber Welten innere

Reise des Herzens durch Spirit; an die Neue Energie oder das Bewusstsein der Neuen Zeit ... wir sie also an... diese Reise zu uns selber ... Diese Reise ist nur möglich wenn wir bereit sind und unsere ehrliche Absicht
zauberwelten.ch Innere Reisen Und Meditationen Durch Alte Zeiten
637 Swiss Bike Tours
8335
Hittnau
Willkommen bei Swiss Bike Tours dem Mountain Bike Reise Anbieter aus der Schweiz. Wir bieten ... Sie sich um über ein Feedback würden wir uns freuen. Kontakt info swiss-bike-tours Unsere nächste internationale Reise
swiss-bike-tours.ch
638 Magicchris Kein Zauberer wunderbar

Hier finden Sie das "Reisebüro" von MagicChris das nur eine Art von Reisen anbitet. ... auf Reisen in die Welt der Magie. Kinder dürfen hier sehr viel selber mitwirken und zaubern
magic-chris.ch Wunderbar Fantastisch Unglaublich Wunderbar
639 Interreligiös Reisen
8820
Wädenswil
... Direkt zum Inhalt Ihr Account Kontakt Reisen Reisen durchstöbern Durchgeführte Reisen Reiseberichte
ir-reisen.ch
640 Last Minute Ferien 2014:

Hier finden Sie Last Minute Ferien Last Minute Reisen und Last Minute Urlaub: Die ... Navigation Content Lastminute Ferien Lastminute Flüge Lastminute Reisen Lastminute
ferien-last-minute.ch
641 Herzlich willkommen bei Event Incentivereisen

Herzlich willkommen bei event reisen in Luzern. Wir haben uns auf die Planung und Durchführung
eventreisen.ch Incentivereisen Belohnungsreisen Weinreisen Gourmetreisen
642 :Alles rund um Dialyse Feriendialyse Dr.Berger und Partner GbR feriendialyse
35578
Wetzlar
... Monday .. Alles rund um Dialyse und Reise Feriendialyse Dr.Berger Willkommen zur Feriendialyse
dialyse-reise.ch Feriendialyse Liebe Berger Ihnen
643 Topreise.ch Lastminute Intercom Network AG reisen
6010
Kriens
topreise.ch Reisemarkt Schweiz. Tausende Reiseangebote Last Minute Angebote. Reisen zu tollen Preisen ... Startseite AGB Kontakt Reise-Angebote Lastminute Pauschalreisen Singlereisen
topreise.ch Reisen Ferien Flugtickets Travel Ferien Reisen Urlaub Last
644 Jaku GmbH Jaku GmbH "Hochzeit
9100
Herisau
Hochzeit Reise Individualreise Hochzeitsplaner Hochzeitsfotografie Fotografie Gesang Trau ... Home Hochzeitsplanung Fotografie Musik Reisen Team Kontakt Trau dich... "Es zählt
jaku.ch "Hochzeit Reise Individualreise Hochzeitsplaner
645 Hotels weltweit Ferien ferien

Ferien und Reisen buchen Flug und Hotel finden online buchen Last Minute ... ¤nde und faszinierende Kulturen.. TOP HOTELS Hotels weltweit.. STÄDTE REISEN Faszinierende Städte
travelglobe.ch Ferien Reisen Flug Hotel
646 Home Reichlin Reisen Reichlin Reisen AG ReichlinReisen
6410
Goldau
... Reichlin Reisen AG I Goldau Schwyz I Tagesfahrten ? Mehrtagesfarhten ? Bibione ? Weihnachtsmärkte
reichlincar.ch ReichlinReisen AG Reichlin Reisen Goldau
647 Traumdestination.ch Herzlich Willkommen traumdestination

Traumhafte Reisen buchen Sie hier bei Traumdestination.ch Das Schweizer OnlineReisebüro!
traumdestination.ch Traumdestination Traumdestinationen Reisen Lastminute
648 Wandern in der Sahara Wüstenreisen

indigo reisen ist Spezialist für Kameltrekking Méharée Wandern und Kamelreiten in der Wüste ... Willkommen Home Aktuell Reisen die stattfinden Reisedaten Wann buchen? Tipps Kontakt Unsere
indigoreisen.ch Wüstenreisen Sahara Kameltrekking Wüste Méharée Nordafrika
649 Limousinenzentrale Schweiz VIP

VIP Limousinenservice Reisen Transfer Personenschutz PersonenbegleitungSchweizer VIP Limousinenservice Limousinenfahrten Personenbegleitung Personenschutz Transfer ... Limousinenservice Personenschutz Personenbegleitung Reisen Transfer Hochzeitsfahrten Fahrzeuge Mercedes S-Klasse
limousinenzentrale.ch VIP Limousinenservice Reisen Transfer Personenschutz PersonenbegleitungSchweiz
650 Batweb.ch Reisen um Sins

Bilder aller Art ... Reisen um zu reisen und nicht anzukommen Neuseeland Australien Normandie Home Home Gallery Comics
batweb.ch Sins 5643 Batweb Gallery
651 Thailand Bangkok Asien

Thailand Reisen Asien Reisen Thailand Travel Asia Travel Ethnik Reisen nach ... . Unsere Stärke liegt in der Organisation von Reisen nach Asien im speziellen nach Thailand Myanmar Laos
hlayer.ch Asien Reisen Asia Travel
652 Home travelshop AG Reisebüro
4002
Basel
Willkommen bei travelshop dem Spezialisten für individuelles Reisen. Wir lieben und leben das Reisen. ... Äthiopien Kultur und Geschichte Land und Leute Gesundheit Wissenswert Reisen und mehr Myanmar Reisebericht
travelshop.ch Reisebüro Reisebüro Reisebüro Basel Reisebüro
653 Isakurt isakurt

isakurt Isabelle Jomini Kurt Dienger moto Töff voyage reise ... ISAKURT Isabelle et Kurt Marokko Agadir .. Rallye-Race Voyages Reisen News Umbau
isakurt.ch Isakurt Isabelle Jomini Kurt Dienger
654 4free.ch Informationen zum

4free.ch ist Ihre erste und beste Informationsquelle über urlaub reisen günstige reisen Hier finden
4free.ch
655 ? Billig Reisen Express Travel International AG
8050
Zürich
Billig Reisen ? Ihr Traumurlaub muss nicht teuer sein! Buchen Sie bei ETI Last Minute ... Travel International AG Eggbühlstrasse CH- Zürich infoexpresstravelinternational Katalog ETI
expresstravelinternational.ch
656 TRAVELexpo Tourismus

Travelexpo organisiert Fachmessen Publikumsmessen und Events im Bereich Tourismus Ferien und Reisen in ... DE FR EN Sitemap Kontakt Die Herbstmesse für Ferien und Reisen . bis . Oktober MESSE
travelexpo.ch Tourismus Messe Ferienmesse Messe Luzern
657 Sambia Reisen | Sambia

Sambia Reisen und Sambia Safaris. Sambia welches von Vielgereisten noch als 'das wahre Afrika' ... SwissAfrican Destinationen Erlebnisse Reisen Zambia Unterkünfte Reisebeispiele Insidertipp HÃ
zambia-reise.ch
658 Vögele Reisen Mehr Badeferien

Badeferien Geführte Rundreisen Vögele Reisen. Sonne tanken an den schönsten Stränden rund ums
tuispecials.ch Badeferien Geführte Rundreisen Rundreisen Last Minute Kreuzfahrten Safaris
659 Sägesser Reisen: Sägesser Reisen Sägesser Reisen AG
4451
Wintersingen
... Sägesser Reisen AG CH- Wintersingen Telefon Blumattstrasse infosaegesser
saegesser-reisen.ch
660 Arvista.ch Reisen

Reisen Mongolei Bhutan Nomaden Treckings
arvista.ch Reisen Mongolei Bhutan Nomaden
661 Vagabund Reisen

... Vagabund Reisen Direkt zum Seiteninhalt Hauptmenü Home Firma Reisemagazin Reisen Dienste Bus
vagabundreisen.ch
662 Ocean Race Charter Oceanrace

Oceanrace organisiert eine Reise an den Americas Cup nach Valencia auf einem Zuschauerboot.Mit ocean race ... organisiert Reisen an die wichtigsten Segelregattas inkl. Flüge und Unterkunft sowie das gesamte Event
oceanrace.ch Oceanrace Organisiert Eine Reise An Den Americas Cup
663 BrasilienPortal Das Original Brasilien

Das riesige Brasilien Infoportal: Nachrichten und Reportagen über Geschichte Kultur Sport ... BrasilienPortal - Alle Infos über Brasilien Home Brasilien Kultur Lifestyle Sport Wissen Reisen
brasilienportal.ch Brasilien Reise Sport Natur
664 Namibia Reisen | Namibia

Namibia Reisen und Namibia Safaris. Namibia verzaubert mit endlosen Weiten von Fels Sand und ... ¶hepunkte Reiseinfos Safaris und Reisen in Namibia Eingeklemmt zwischen der Namib Desert und der Kalahari
namibiareise.ch
665 Ferienfabrik Angebote Lastminute Ferienfabrik

Egal ob Strandurlaub Städtereise Flugreise Kreuzfahrt oder Lastminute Urlaub auf Ferienfabrik.de findet ... )NürnbergPaderbornRostockSaarbrückenSalzburg SchwerinStrasbourg StuttgartWarschau Wien Zürich Zweibrücken Ziel der Reise
ferien-fabrik.ch Ferienfabrik Urlaub Reisen Günstig
666 RubiReisen Bus Reisen
3800
Interlaken
Ihr Reisespezialist für exclusive Europarundreisen im Bus ... Reisen Postfach CH- Interlaken Telefon + + info
rubi-reisen.ch Reisen Rundreisen Transfer Transfers Worldsoft Vereinsausflüge Interlaken Schwei
667 DelSolar reisen

...  delSolar reisen delSolar reisen Spiegelgasse Zürich Schweiz Telefon +
delsolar-reisen.ch
668 PRAXIS RENATE NUSSER | The

The Journey ist eine einfache und kraftvolle Prozessarbeit welche uns hilft mit der ... oder auch innere Reisen genannt helfen beschwerliche Themen und Probleme an der Wurzel anzugehen Blockaden Ã
renate-nusser.ch The Journey Journey Innere Reise
669 Über uns Kataloge Island Tours AG island
5200
Brugg
Island Tours Schweiz bietet Ihnen ein grosses Angebot an Island Reisen. Pauschalangebote sowie individuelle Angebote ... Island Tours Switzerland Seit Ihr Spezialist für gelungene Reisen nach Island Grönland
islandtours.ch Island Tours Schweiz Reisen
670 Digital.ch | Herzlich Willkommen Schweiz

digital.ch ist eine private Homepage in der wir von unserer Reise von der Schweiz nach ... Home Reise Tagebuch Bildergallery VW Bus Gästebuch Verschiedenes Herzlich willkommen bei digi
digi-tal.ch Schweiz Frankreich Spanien Afrika Marokko Angola Benin Botsuana
671 Willkommen bei River Tours River

Flusskreuzfahrten sind eine besonders bequeme und erholsame Art des Reisens und doch so erlebnisreich. Tauchen ... Sie unseren Service. Auf einer entspannten und außergewöhnlichen Reise ? durch traumhafte Landschaften
river-tours.ch River Tours AG Basel
672 Home Motovia fahrschule

fahrschule reisen touren motorrad marcel heimann jeanpierre gold ... eine unglaubliche Anzahl an Möglichkeiten. Reisen Schnupperkurse Fahrausbildung Grundkurse oder Fahrtrainings
motovia.ch Fahrschule Reisen Touren Motorrad
673 Mit Mövereisen Gesundheit neu reiseveranstalter

reiseveranstalter mövereisen reisen carreisen ferien urlaub gesundheit tagesreisen ... Menu Home Startseite Home Startseite Information Information AGB-Reisen AGB-Reisen Programm
moevereisen.ch Reiseveranstalter Mövereisen Reisen Carreisen
674 Alternative Coaching Tiffany Reiser Reiser

Coach professionnel pour vous accompagner et vous soutenir dans vos démarches de développement personnel afin
alternativecoaching.ch Reiser Tiffany Aide Alternative
675 R. Reiser

... Hello! - You are about to visit the Homepage of Renatus Reiser Zurich (Switzerland
reisi.ch
676 Langsamreisen Peter Luder langsamreisen

Reisen zur Landschaft in der Schweiz und in Norwegen: Wanderungen im Sommer und Winter. Langsamreisen ... "Reisen ist besser als Verweilen." Samisches Sprichwort Aktuelle Seite Aktuell Nach oben
langsamreisen.ch Langsamreisen Langsam Reisen Langsom Reise
677 Last Minute Flüge: Lastminute

Lastminute Flüge: Hier finden Sie Last Minute Flüge Last Minute Ferien Reisen und ... Für sehr spontane Zeitgenossen besteht auch die Möglichkeit Last Second Reisen und Last Second Ferien
lastminute-fluege-buchen.ch
678 Green Golf Golfen reisebüro

Golfferien Angebote vom Golf Profi. Wir bieten Ihnen erstklassige Golf Hotels Golf Rundreisen ... Golplätze Datenbank Green Golf Blog Partner Links airportparking Jet Reisen Jet Sprachreisen
greengolf.ch Reisebüro Golf Golfferien Golfreisen
679 Wohnmobil mieten ABC kaufe

miete Wohnmobil Camping Ferien Vermietung Verkaufen Camper Mieten
abcsteinwomo.ch Kaufe Miete Wohnmobile Camping
680 Jetstar.ch Informationen zum

jetstar.ch ist Ihre erste und beste Informationsquelle über fliegen flieger reisen urlaub ferien Hier ... Reise um die Welt« Noris Gr Preis EUR Kinderspiel »YooHoo Friends - Die lustige Reise
jetstar.ch
681 Reisebüro Scorpio Winterthur Reisebüro
8400
Winterthur
Grenzenloses Ferienvergnügen mit Scorpio Reisen. Pauschalangebote LastMinute Ferien und vieles mehr! Sie persönlich zu ... willkommen! Reisebüro Scorpio AG in Winterthur Ihr Spezialist für individuelle Reisen persönliche
scorpio.ch Reisebüro Scorpio Winterthur Reisebüro Scorpio
682 Flüge Fluege Philippinen Thailand anderes reisen GmbH Philippinen
88250
Weingarten
Asien Philippinen Flüge Australien Neuseeland anderes reisen Reisebüro Fernreisen bietet alles zu sehr guten ... Lanka Studententarife Sprachreisen Hochzeitsreisen Reisen Helfen Australien Neuseeland Kuba Afrika
anderes-reisen.ch Philippinen Philippines Manila Flüge Für
683 Scottys Reisen Home Tauchferien

Bei Scotty's Reisen geniessen Sie sehr gute Beratung gestuetzt durch ein Knowhow von 30
vitalreisen.ch Tauchferien Surfferien Wellnessferien Golfreisen Weinreisen Polar Expeditionen C
684 Freevideo.ch Informationen zum

freevideo.ch ist Ihre erste und beste Informationsquelle über Reisen Hier finden Sie auch weitere
freevideo.ch
685 Scottys Reisen Home Tauchferien

Bei Scotty's Reisen geniessen Sie sehr gute Beratung gestuetzt durch ein Knowhow von 30
gesundheits-reisen.ch Tauchferien Surfferien Wellnessferien Golfreisen Weinreisen Polar Expeditionen C
686 Ungerwaegs.ch  Informationen zum Thema Reisen.

ungerwaegs.ch ist Ihre erste und beste Informationsquelle über Reisen Hier finden Sie auch weitere
ungerwaegs.ch
687 Ägypten Rundreise mit Norbert Ägypten

ÄgyptenRundreise mit Norbert Lüchinger Ägypten Gruppenreise PrivateReise Rundreise Kairo Pyramiden ... Lüchis' Ägyptenreisen Home Reise Preis Reiseleitung Organisation Fotos Kontakte ÄGYPTENRUNDREISE
aegyptenreisen.ch Ägypten Gruppenreise PrivateReise Rundreise
688 Home KAB Chur KAB
7000
Chur
KAB Chur ? Aktives Mitgestalten an der Vereinszukunft von Chur: St. Nikolaus Thater Jassen ... Impressionen Jassmeisterschaft Brücke · Le pont Rückblick Reisen Rückblick
kab.ch KAB Chur Verein Jugend
689 Herzlich Willkommen auf MotoTours.com motorrad
5432
Neuenhof
Mototours organisiert spezielle Reisen mit dem Motorrad in ganz Europa. Reservieren Sie jetzt einen Platz ... Home MotoTours MTS-Reisen Isle of Man Vietnamtours MotoTours SÜDAMERIKA ANDEN AFRIKA
mts-reisen.ch Motorrad Moto Zweirad Motorräder
690 Japan direkt Hauptmenü Japan

Reisen nach Japan ... Ansichtssuche Navigation Suchen Aktuelle Seite Home Hauptmenü Japan News Links Über uns AGB's Kontakt Reisen
japan-direkt.ch Japan Nippon Tokyo Kyoto Hokkaido Kyushu Okinawa
691 Werners Homepage Roller

Berichte und Fotos über Reisen mit PK125XL AN125 UC125 Epicuro AN400 AN650 ... Reisen Motos Privat England -> mit der Vespa im Linksverkehr Oslo-Stockholm
tannware.ch Roller Motorrad Reisen Skandinavien Baltikum Nordkap Island Rumänien
692 Riechsteiner Weber AG Carreisen

Riechsteiner Weber AG Carreisen Transporte und Mineralölhandel Aarauerstrasse 621 CH ... RIECHSTEINER WEBER AG Reise- und Transportunternehmen Aarauerstrasse CH - Muri AG Abt
riechsteiner-weber.ch Carreisen Carunternehmen Busreisen Reisen Transporte Heizöl Dieselöl Riechsteine
693 Reisen / Reittrekking / Reisen

Reiseen / Reittrekking / Naturreisen / Kanutouren in Kanada und Alaska Canada / Canadian ... Kenntnis über Kanada an Sie werden es nicht bereuen. Wir verkaufen Ihnen nicht nur Reisen
canadatrail.ch Reisen Reittrekking Naturreisen Kanutouren
694 Herz reisen

... herz-reisen Einfangstrasse Bürglen Tel + + infoherz
herz-reisen.ch
695 Reise durch Amerika Route
9200
Gossau
Reiseberichte und Reisetipps für Amerika ... Reise durch Amerika Startseite Unsere Reisen durch Amerika Reisetipps für die USA Traudl on tour
reise-durch-amerika.ch Route 66 Lincoln Highway Reisebericht
696 Sonnenschein Reisen Sonnenschein Reisen GmbH
7500
St. Moritz
... ... finden Sie hier Unsere Top-Reisen by FTH hosted by INODE
sonnenschein-reisen.ch
697 Pascal Reis

Fotografie ... content by Pascal Reis
pascalreis.ch
698 Lombi Reisen

...  Lombi Reisen This page uses frames but your browser doesn't support them.
lombi.ch
699 Lastbeachreisen lastbeachreisen

Fast alle Veranstalter Riesenauswahl auf Wunsch auch mit etwas Abenteuer. Erfahrene Ansprechpartner
lastbeach-reisen.ch Lastbeachreisen Lastbeach Last Beach Reisen
700 Book at Home Bernhard Reisen AG bernhard
9403
Goldach
Bookathome.ch ist die Internetseite von Bernhard Reisen AG. Wir sind Ihr kompetentes und unabhängiges Reisebüro ... für jeden das Richtige und für alle etwas Besonderes. zum Angebot Bernhard Reisen AG Hauptstrasse CH- Goldach Tel
flugscheine.ch Bernhard Reisen Magic Life Euböa
701 Asiangatetravel.ch reisen

reisen weltweit rundreisen sprachschulen renato probst probst renato asien ... in sachen reisen . proches . innovateurs . diversifiés . originaux et . coopératifs . nah . innovativ
asiangatetravel.ch Reisen Tourismus Weltweit Asien Afrika Consulting Guide Europa
702 Haecki Reisen
6390
Engelberg
... Startseite Kontakt Reise-Angebote Taxi ‹ › Sie befinden sich hier Startseite Haecki
taxi-haecki.ch
703 Hotel Reiser
6460
- Altdorf
... Reservation Deutsch English + infohotelreiser Boutique Hotel Reiser Zu Hause
hotelreiser.ch
704 Startseite INSeminare Coaching

IN Seminare Ihre Partner für Seminare Coachings und Standortbestimmung Reisen mit Inhalt ... Selbstständig Budget Eltern Herbstzeitlose Reisen Auszeit mit INhalt Indien Ghana Costa Rica Finnland Brasilien
in-seminare.ch Coaching Karriereberatung Standortbestimmung Seminare Seminare
705 Ihr billiger Flug fürs Sri
3012
Bern

etravels.ch Sri Lanka Reisen Billiger Flug
706 Momente Augenblicke in

... MOMENTE - Augenblicke in unseren Reisen. MOMENTE - Augenblicke in unseren Reisen. MOMENTE
b-ruegger.ch
707 Mesic Reisen

Das Kroatien bietet während des ganzen Jahres sehr viele Möglichkeiten für Jedermann. Sei es Sport ... -LUZERN-ZAGREB ZÜRICH-PULA-POREC-ROVINJ GUT ZU WISSEN CH REISENDE REISE INFOS KROATIEN ISTRIEN KVARNER
mesic-reisen.ch
708 Reise nach Ägypten

... ??? Reise nach Ägypten Tutankhamun Die Reise nach Ägypten Ägypten Pyramiden Ägypten Unterkünfte
tutankhamun.ch
709 Viptrip Reisen

viptrip.ch organisiert Reisen und Events für den Netzwerkausbau der VIPTeilnehmer.
viptrip.ch Reisen Events Geschäftsreisen Netzwerk Networking
710 Anja's Reisen | ?begleite

... Anja's Reisen ?begleite mich auf meinen Reisen?. Suchen Hauptmenü Zum Inhalt wechseln
anjasreisen.ch
711 Pbooking.ch pbooking
5405
baden ag - dättwil
In einem Zeitalter in dem eine Reise online zu buchen oder eine Pizza online ... -booking In einem Zeitalter in dem eine Reise online zu buchen oder eine Pizza online zu bestellen
p-booking.ch Pbooking Kunden Bieten Restaurantbetrieb
712 Ferien Last Minute lastminute

Wir bieten Flüge Hotels Last Minute Angebote Badeferien Ferienwohnungen Mietwagen und ... - Reisebörse Lufthansa City Center! Zahlreiche Angebote unserer Spezialabteilung für Reisen in die USA finden
nurmietwagen.ch Lastminute Last Minute Badeferien Reisebörse
713 Estissimo voyages / Estissimo Circuits

Circuits d'Estissimo atelier des voyages suisse spécialisé en circuits culturels à l'est de l'Europe ... Estissimo langues et voyages Passage Marval CH- Neuchâtel Tél + +
estissimo.ch Circuits Culturels En Europe De L'Est Circuits
714 Bollywoodindia.ch Inhaltsverzeichnis vijay

vijay kumar singh http://www.singh.ch/ Indien Reisen Zürich http://www.indienreisen.ch/ hinduismus http://www.hinduismus.ch/ ... Neuste Filme – Ausschnitte aus verschiedenen Zeitungen Reisen zu indischen Filmstudios und nach Indien
bollywoodindia.ch Vijay Kumar Singh Http://www.singh.ch/ Indien Reisen
715 Pauschalreisen mit alltours Alltours

Buchen Sie ihren Pauschal Urlaub bei alltours. Übersichtlich und sofort Verfübar. Günstige Reisen online bei ... Salzburgaustria Wienaustria Hinweis Alle Reisen auch direkt auf www.alltours buchbar. Alle Abflughäfen
sunlife.ch Alltours Urlaub Last Minute Pauschal
716 Gesundreisen.ch Home gesundreisen.ch
8840
Einsiedeln
Gesund Reisen: individuelle reisemedizinische Beratung offizielle Gelbfieberimpfstelle Malariaprophylaxe spezifische Impfberatungen. Sprechstunde nach Vereinbahrung ... ! Die reisemedizinische Praxis Dr. med. Svend Capol ist die Anlaufstelle für reisemedizinische Beratungen vor der Reise
gesundreisen.ch Gesundreisen.ch Gesund Reisen Gesundreisen Travelclinic
717 Günstige Reiseangebote ab der ATB International Services & Consulting GmbH Reiseangebote
06108
Halle
Super Lastminute Reiseangebote Frühbucherrabatte. Über eine Millionen günstige Reisen vergleichen online buchen und ... GmbHAlltours X Flugreisen GmbHAMA Reisen GmbHAmeropa-Reisen GmbHAttika Reisen GmbH Co. KGBavaria Fernreisen
12-travel.ch Reiseangebote Ferienangebote Günstige Reisen Lastminute
718 Reisen in Vietnam
8001
Zürich
japan rail pass online bestellen gratis lieferung weltweit ohne gebühr mit kreditkarte bezahlen japan rail pass order online free ... Zugriffe Hier finden sie unseren aktuellen Angebote für Reisen nach Vietnam. Kategorie Südostasien
vietnam-reise.ch
719 Alpenexpress.ch Reisen Hotellerie www.alpenexpress.

Die Seite www.alpenexpress.ch gehört zum HelpmediaNetzwerk. ... Firmenporträts Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG
alpenexpress.ch Www.alpenexpress.ch Information Info News
720 Aperotram.ch Reisen Hotellerie www.aperotram.ch

Die Seite www.aperotram.ch gehört zum HelpmediaNetzwerk. ... Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG SH SO SZ TG TI
aperotram.ch Www.aperotram.ch Information Info News
721 Ferienratgeber.ch Reisen Hotellerie www.ferienratgebe

Die Seite www.ferienratgeber.ch gehört zum HelpmediaNetzwerk. ... Firmenporträts Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG
ferienratgeber.ch Www.ferienratgeber.ch Information Info News
722 ETicketing.ch Reisen Hotellerie www.eticketing.ch

Die Seite www.eticketing.ch gehört zum HelpmediaNetzwerk. ... Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG SH SO SZ TG TI
eticketing.ch Www.eticketing.ch Information Info News
723 Bahnfahrplan.ch Reisen Hotellerie www.bahnfahrplan.

Die Seite www.bahnfahrplan.ch gehört zum HelpmediaNetzwerk. ... Firmenporträts Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG
bahnfahrplan.ch Www.bahnfahrplan.ch Information Info News
724 Cocktailrezepte.ch Reisen Hotellerie www.cocktailrezep

Die Seite www.cocktailrezepte.ch gehört zum HelpmediaNetzwerk. ... Firmenporträts Handelsregister-Neugründungen PLZ Ort ganze CH AG AI AR BE BL BS FL FR GE GL GR JU LU NE NW OW SG
cocktailrezepte.ch Www.cocktailrezepte.ch Information Info News
725 Europacenter.ch Reisen Hotellerie www.europacenter.

Die Seite www.europacenter.ch gehört zum HelpmediaNetzwerk.
europacenter.ch Www.europacenter.ch Information Info News
726 Firstclasstravel.ch Reisen Hotellerie www.firstclasstra

Die Seite www.firstclasstravel.ch gehört zum HelpmediaNetzwerk.
firstclasstravel.ch Www.firstclasstravel.ch Information Info News
727 Flughafenbahn.ch Reisen Hotellerie www.flughafenbahn

Die Seite www.flughafenbahn.ch gehört zum HelpmediaNetzwerk.
flughafenbahn.ch Www.flughafenbahn.ch Information Info News
728 Flughafenhotels.ch Reisen Hotellerie www.flughafenhote

Die Seite www.flughafenhotels.ch gehört zum HelpmediaNetzwerk.
flughafenhotels.ch Www.flughafenhotels.ch Information Info News
729 Silvesterschiff.ch Reisen Hotellerie www.silvesterschi

Die Seite www.silvesterschiff.ch gehört zum HelpmediaNetzwerk.
silvesterschiff.ch Www.silvesterschiff.ch Information Info News
730 Silvesterreise.ch Reisen Hotellerie www.silvesterreis

Die Seite www.silvesterreise.ch gehört zum HelpmediaNetzwerk.
silvesterreise.ch Www.silvesterreise.ch Information Info News
731 Speiserestaurants.ch Reisen Hotellerie www.speiserestaur

Die Seite www.speiserestaurants.ch gehört zum HelpmediaNetzwerk.
speiserestaurants.ch Www.speiserestaurants.ch Information Info News
732 Showkochen.ch Reisen Hotellerie www.showkochen.ch

Die Seite www.showkochen.ch gehört zum HelpmediaNetzwerk.
showkochen.ch Www.showkochen.ch Information Info News
733 Showmixkurse.ch Reisen Hotellerie www.showmixkurse.

Die Seite www.showmixkurse.ch gehört zum HelpmediaNetzwerk.
showmixkurse.ch Www.showmixkurse.ch Information Info News
734 Skytower.ch Reisen Hotellerie www.skytower.ch

Die Seite www.skytower.ch gehört zum HelpmediaNetzwerk.
skytower.ch Www.skytower.ch Information Info News
735 Lastminuteticket.ch Reisen Hotellerie www.lastminutetic

Die Seite www.lastminuteticket.ch gehört zum HelpmediaNetzwerk.
lastminuteticket.ch Www.lastminuteticket.ch Information Info News
736 Kurfuerstendamm.ch Reisen Hotellerie www.kurfuerstenda

Die Seite www.kurfuerstendamm.ch gehört zum HelpmediaNetzwerk.
kurfuerstendamm.ch Www.kurfuerstendamm.ch Information Info News
737 Kocharena.ch Reisen Hotellerie www.kocharena.ch

Die Seite www.kocharena.ch gehört zum HelpmediaNetzwerk.
kocharena.ch Www.kocharena.ch Information Info News
738 Ljubljana.ch Reisen Hotellerie www.ljubljana.ch

Die Seite www.ljubljana.ch gehört zum HelpmediaNetzwerk.
ljubljana.ch Www.ljubljana.ch Information Info News
739 Lunchbons.ch Reisen Hotellerie www.lunchbons.ch

Die Seite www.lunchbons.ch gehört zum HelpmediaNetzwerk.
lunchbons.ch Www.lunchbons.ch Information Info News
740 Lunchbon.ch Reisen Hotellerie www.lunchbon.ch

Die Seite www.lunchbon.ch gehört zum HelpmediaNetzwerk.
lunchbon.ch Www.lunchbon.ch Information Info News
741 Lunchchecks.ch Reisen Hotellerie www.lunchchecks.c

Die Seite www.lunchchecks.ch gehört zum HelpmediaNetzwerk.
lunchchecks.ch Www.lunchchecks.ch Information Info News

Reise Irland Reisen AngebotIrland Schweiz Reise - Die Öffnungszeiten können zu Feiertagen Pfingsten, Fronleichnam, Reformationstag und Allerheiligen abweichen. Statistiken: 5 StadtBranche Punkte für "Reise " - In die Bewertung wird die Anzahl der Besucher und Erfahrungsberichte dieser Themenseite mit einbezogen. Kontakt + Reise › Irland Reisen Angebot Schweiz - Reise Bewertungen Öffnungszeiten und Erfahrungen. Stand:

Neuer Eintrag 

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Warenverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen . Auch im Wirtschaftsverkehr werden Reisen unternommen . Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort. Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette . Reise Öffnungszeit und Erfahrungen