optional Stadt:
Schweiz › Ort ›

Rütihof › Aargau › Österreich › 5406 Erfahrungen

Branchenbuch Rütihof

5406 Aargau

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:




1 deLadevoBade CBD Shop ch
5400
Baden
CBD ist unsere Leidenschaft. Wir haben 6 exklusive CBD Sorten, CBD Tinktur und CBD Öl im Angebot. Alle CBD Produkte...
deladevobade.ch Z Y
2 Boilerkings Boiler ch
5406
Rütihof
Warmwasser? Ja gerne!...
boilerkings.ch Boiler Warmwasser Kings Warmwasseranlagen Tobelacher Baden Rütihof Internetauftritt Steffen Rtihof Neuenja Demnchst
3 Loogo Umzüge Österreich Umzüge at
5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
4 Hundetrainer Hundetrainer Hundeschule Hundetraining ch
5408
Ennetbaden
Wir trainieren nicht Ihren Hund, wir trainieren Sie, damit Sie Ihren Hund trainieren können. Hundetraining in alltäglichen Situationen, denen wir immer...
hundeschule-aargau.com Hundeschule Erziehungskurse Junghundekurse Hundehalterbrevet Agb Clicker Training Uns Feedbacks Verhaltensanpassungen Aargau Wettingen Baden Trainieren Umgebung Fislisbach Nussbaumen
5 Adless Mediendesign e.U. Webdesign at
5400
Hallein
wir gestalten Medien - Web, Grafik & Druck...
adless.at Navigation Offsetdruck überspringen Webdesign Relaunch Augenhöhe Werbeagentur Grafik + Grafikdesign Angebot Web Uns Rufen Beratung
6 Ihr Schweizer Mietportal Baumaschinen-Vermietung ch
5408
Ennetbaden
Wir sind rentscout Ihr Schweizer Mietportal. Finden Sie auf rentscout alles zum mieten und vermieten. Wir führen das ganze Sortiment...
rentscout.ch/produkte/bau-landwirtschaft.html Zubehör Zelte Toiletten Duschanlagen Tontechnik Bus Mobiliar Bühnen Car Küche Pflanzen Aufzüge Container Dekorationen Bodenbeläge Reinigungsgeräte Stretch Limousinen Rsaquo
7 Loogo Umzug Umzug Umzüge at
5400
Hallein
Jeder Umzug wird von uns mit höchster Priorität und Wichtigkeit behandelt und mit Freundlichkeit, Professionalität und vor allem kundenorientiert zum...
loogo.at Salzburg Umzug Umzugs Loogo Lagerung Mail Kontaktieren Eu Transport Kalkulator Firmenumzug Besichtigungstermin Kunden Kostenlosen Storage Self Entrümpelung
8 1820 Telefonauskunft der Schweiz Kommunikation Dialog ch
5405
Baden-Dättwil
1820 - Die Schweizer Telefonauskunft mit persönlichem Service erfahrener Schweizer Mitarbeiter/innen. Nationale und internationale Auskünfte aller Art, rund um die...
18-20.ch Z Y
9 Praxis Dr. Wanner Arzt ch
5405
Daettwil
plastische Chirurgie Wiederherstellungschirurgie, ästhetische Chirurgie, Face Lifting, Nasenplastik, Tumorchirurgie, Brustvergrößerung, Brustverkleinerung, Bruststraffung, Bauchdeckenstraffung, Liposuction, Brustrekonstruktion, Botox, Hyaluronsäure, Faltenbehandlung, Peeling, Narbenkorrektur...
aesthesis.ch Chirurgie Damit Aesthesis Unerwünschte Navigation Alters Aktuell Behandlungen Unfälle Zeichen Praxis Gemäldeausstellung Nachbetreuung Return Physikalische Plastischer Einfluss
10 Wimpernverlängerung & Nail Wimpernverlängerung & Nail Cosmetic ch
5408
Ennetbaden
Im Studio SALANA Lashes & Nails in Ennetbaden bieten wir Ihnen alle Behandlungen an die zur Pflege und Verschönerung Ihre...
salana.ch Lashes Wimpernverlängerung Nails Remigen Salana Ennetbaden Chf Pedicure Statt Manicure Shellac Portrait Gelnägel Seidenwimpern Wimpernlänge Ennetbadensonnenbergstrasse News Frick
11 EMCO Werkzeugmaschinen Drehmaschinen Fräsmaschinen Fräsen at
5400
Hallein
EMCO ist ein weltweit führender Werkzeugmaschinen Hersteller von Drehmaschinen und Fräsmaschinen. Der Erzeuger arbeitet nach modernsten und internationalen Standards und...
emco-world.com/ Emco Cnc [] Ausbildung News Fräsmaschinen Industrie Produkte Drehmaschinen Erzeuger Drehen Kundenservice Kundendienst Unternehmen Consulting Ersatzteile Schulungen Leistungsfähige Gebrauchtmaschinen
12 REYERlooks Designermoden Onlineshop Onlineshop Mode at
5400
Hallein
Designermode im Fashion Online shop REYERlooks! Die neuesten Trends den richtigen Style und die besten Designer. Designermode ohne Kompromisse! DER...
reyerlooks.com/ Trends Designer Reyerlooks Shop Fashion Mode Kleider Taschen Designermode Urban Mäntel Bags Schuhe Röcke Jacken Passend Winter Shoes Sicher Anrede*
13 PC-Reparatur COMPUTER Service at
5400
Hallein
Herzlich Willkommen bei Ihrem CXPC-Service Team für Computer, Büro, Gaming, Multimedia PC´s und Ersatzteile. Wir haben unser Interesse für Computer...
cxpc-service.at Pc Computer Cxpc Finden Radeon System Amd Pc´s Budget Beratung Systeme Mini Technik Erfahrung Reparatur Kontaktformular Nutzen Edv Dienstleistung Ihrem
14 Nailstyling Fiedler Nailstyling Fiedler Naildesign ch
5408
Ennetbaden
Naildesign, Gelnägel, Permanent Nagellack CND, Wimpernverlängerung, Wimpernverdichtung, Manicure, Pedicure...
nailstyling-fiedler.ch Domain Kas Mail Movetec Thema Nailstyling Switch Fiedlerch Domains Logo Schweiz Angriffe Ab Registrar Betriebsferien Fiedler Kunden Level Kundenmeinung Queensbeautych
15 Nailstyling Fiedler Nagelkosmetik ch
5408
Ennetbaden
Naildesign, Gelnägel, Permanent Nagellack CND, Wimpernverlängerung, Wimpernverdichtung, Manicure, Pedicure...
nailytling-fiedler.ch
16 Helga M. Schnattinger Alternativmedizin at
5400
Hallein
Kinesiologie, Tuina, Familienaufstellung sowie Schamanismus und Rückführung bietet Helga Schnattinger in Hallein bei Salzburg - Gesundheitstrainerin und Diplomtherapeutin für traditionelle...
helga-schnattinger.at/ Kinesiologie Tuina Schamanismus Rückführung Helga Schnattinger Familienaufstellung Salzburg Hallein Seminare Sowie Kintao Reinkarnation Homöopathie Familienstellen über Meiner
17 New Media Context Lektorat ch
5400
Baden
Die beste Adresse für Lektorat, Lehrmittel- und Medienprojekte. Spezialisiert auf das Lektorat von Bachelor-, Master-, Doplom- und Doktorarbeiten begleitet NMC professionell...
nmc.ch Lektorat Lehrmittel Dissertation Masterarbeit Hilfe Media Context Nmc Studienabschluss Diplomarbeit Bachelorarbeit Projektleitung Medienprojekte Projektplanung New Mdash Mail
18 Sylvi Nicolai, Dolmetscherin und Dolmetschen ch
5400
Baden
Sie organisieren eine Konferenz oder benötigen für Geschäftsverhandlungen, Führungen oder Präsentationen einen zuverlässigen Dolmetscher? Oder benötigen Sie eine Übersetzung Ihrer...
sprachendienst.ch Translation Dolmetschen Baden Zürich Bern übersetzen Lektorat Interpreting Traducción Deutsch Sylvi English Schweiz Partner Kommunikation Kongresszentrum übersetzungen Agency Copyright
19 Mertl-Kunststoff GmbH Kunststoff und at
5400
Hallein
MERTL Kunststoffe GmbH - Verschiedenste Produkte wie : Thermoplastische Werkstoffe Duroplastische Werkstoffe ICE FLOOR 365 Eislaufen ohne Eis Gleit- und Förderelemente Rammschutzleisten nach Wunsch kompetenter Partner...
mertl-kunststoff.com Kunststoffe Mertl Thermoplaste Icefloor Duroplaste Fertigteile Halbzeuge Plastix Förderelemente Erfahren Gleit Stellenanzeigen Zertifikat Kunststoff Zuschnitte Premium Werkstoffeund Hochleistungskunststoffe Sowie Pe Werkstoffe Unser
20 Wie können Texte extern Bildung ch
5400
Mäderstrasse 2
Textidee bietet einen einfachen Weg, die Idee, die druckfertigen Text. Jeder schreiben, bearbeiten und die Jahresberichte korrigieren, Unternehmensbroschüren , Redaktionelle...
textidee.ch/ Gregori Regina | Direkt Inhalt Dienstleistungen Textideech Ankommenmich Textidee Z
21 Handeys Finanzen - Kredit Kredit ch
5400
Baden
Kredit, Geldanlage, Darlehen, Privatkredit, Kredit Vergleich, Express Kredit, Kredit ohne ZEK, Sofortkredit, Reisefinanzierung, Schönheitsfinanzierung oder Kredit für Selbstständige? Sind Sie...
handeys-finanzen.ch Kredit Handeys Ferien Finanzen Konditionen Teilzahlung Privat Zürich Express Privatkredit Schweiz Darlehen Sofortkredit Kredite Vergleich Nebenjob Abwicklung Badeferien
22 Psychotherapeutische Praxis Psychotherapie ch
5400
Baden
tafra.ch Romy Fsp Psychotherapie | Tafra Fachpsychologin Licphil Sprachentarife Mich Angebotpraxis Mein Baden
23 Joya City Shop Schuhe at
5400
Hallein
weichster Schuh der Welt ideal bei Hallux und Fersensporn schon Rücken und stärkt Muskulatur Gelenkschonend...
joya-cityshop.at Joya Schuhe Shop Gesunde Komfortschuhe City Schöninger Erfolgsgeschichte Gehen Hallein Alois Kellner Schwelle Wegbereiter Cityshopat Wwwjoya Nater Shophallein
24 Medienquartier Werbeagentur at
5400
Hallein
Internetseite, Webseite, Grafiker, Webdesigner, Werbung, Visitenkarte, Plakat, Broschüre, Logo, Briefpapier, Kuverts, Postkarten, Rollups, Fahnen, Beachflag, Marketing, Social Media, Corporate Design...
medienquartier.at Project Salzburg Grafikdesign Webdesign Hallein Werbeagentur | Medienquartier Work Details Contact Print Cafe Genuss Wahre Maria Consulting
25 Laserer Küchenstudio Salzburg at
5400
Hallein
Küchen sind nicht nur Orte, in denen man Essen zubereitet, sie sind in zahlreichen Fällen ebenfalls Begegnungsstätten. Das Abendessen, wird...
laserer.at/de/kuechen-wohnen/kuechen-kuechenplanung/kuechenstudio-salzburg/ Küchen Küchenstudio Wohnen Salzburg Gosau Hallein Laserer Tischlerei Marken Planung Anfahrt Küchenstudios Siematic Maß Traditionell Einbauküchen
26 moser - productagent Handel at
5400
Hallein
Handel mit Werbemittel, Weihnachtsgeschenke, Betriebsaktionen, Produktsuche, Produktvermittlung, Hallein, Salzburg, Österreich, Producthunter,...
productagent.eu Werbegeschenke Werbemittel Werbung Betriebsaktionen Weihnachten Hallein Salzburg Präsente Wien Business Tennengau Kärnten Linz Vorarlberg Flachgau Kundengeschenke Werbemitteloberösterreich

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Rütihof

+ Kommentar oder Kleinanzeige für Rütihof eintragen!

27 Home Anlässe
5406
Rütihof

sportschiessenbaden.ch
28 Home jpiX.ch by
5406
rütihof
... fotografie jeannine good steinstrasse b ch- rütihof + infojpix www.jpix
jpix.ch
29 Home Anlässe
5406
Rütihof

ps-ennetbaden.ch
30 Home Boden
5406
Rütihof
Th. Keller Fachmann für Bodenbeläge und Wandbekleidungen spezialisiert auf Renovationen und Umbauten ... Th. Keller Bodenbeläge Parkett Vorhänge Beschattungen Thomas Keller Im Steiacher Rütihof Tel
thkeller.ch Boden Bodenbeläge Parkett Vorhänge Beschattungen Rollos
31 Elishacats Britisch Kurzhaar Britisch
5406
Rütihof
... Kurzhaar Hobby-Katzenzucht von Eliane Oster-Baumgartner Baden-Rütihof AG Schweiz Infolge
elisha-cats.ch Britisch Kurzhaar Katzenzucht Elishacats Shamira
32 Www.yvbalance.ch kinesiologie
5406
Rütihof

yvbalance.ch
33 Babytafel Eine kreative
5406
Rütihof
Babytafel: Endlich ist der Nachwuchs da! Geschwister Grosseltern Freunde und Nachbarn freuen sich ... Kathrins Geschenkstafeln Im Tobelacher CH- Rütihof Kontakt Natel infobabytafel
babytafel.ch
34 Kubuss Kubuss
5406
Rütihof
Individuelle und auf Maß gefertigte Einbauschränke und Raumteiler. Auch kundenspezifische Sonderlösungen jenseits von Standards und
kubuss.ch Kubuss Schranksysteme Raumplus Room Divider Sliding Doors
35 Unterwasserbild.ch Unterwasserbild
5406
Baden Rütihof
unterwasserbild.ch
unterwasserbild.ch Unterwasserbild Fotos Bilder
36 Www.storg.ch
5406
Baden Rütihof s. Stadtplan Baden

storg.ch
37 Babygalerie KSB Kantonsspital Baden AG
5404
Baden

babygalerie-ksb.ch
38 Willkommen Plaza Shopping PRIVERA AG
5404
Baden-Dättwil

plazashopping.ch
39 Bauer Automobile in Baden Bauer
5404
Baden-Dättwil
Website der Bauer Automobile AG in Dättwil | Toyota und Lexus Verkauf und Service ... .. Toyota Lexus Kontakt Oberrohrdorferstrasse a CH- Baden-Dättwil
bauerautomobile.ch Bauer Automobile AG Toyota Händler
40 Willkommen Plaza Shopping PRIVERA AG
5404
Baden-Dättwil

plaza-shopping.ch
41 Cédric Wermuth » Startseite Cédric
5402
Baden
Es ist Zeit für klare Worte. Und für eine Politik für alle statt für wenige.
cedricwermuth.ch Cédric Wermuth Nationalrat Wahlkampf
42 Kovats zum scharfen Aug Kovats zum scharfen Aug AG Brille
5402
Baden
Kovats zum scharfen Aug Ihr Spezialist für Kontaktlinsen Brillen ... Rathausgasse CH- Baden + . + Suchen
augag.ch Brille Brillen Linsen Orthokeratologie Interlens Nachtlinse Augenprobleme Sehpro
43 Impfzentrum Baden
5402
Baden
... Zum Inhalt springen Zur Navigation springen Obere Gasse CH- Baden
impfzentrum.ch
44 Lüscher Wohnen | Das M?bel
5402
Baden
L?scher Wohnen Inhaber L?ngle
luescherwohnen.ch M?bel Sofa Liege Lignerose
45 Kovats zum scharfen Aug Kovats zum scharfen Aug AG Brille
5402
Baden
Kovats zum scharfen Aug Ihr Spezialist für Kontaktlinsen Brillen ... Rathausgasse CH- Baden + . + Suchen
nachtlinse.ch Brille Brillen Linsen Orthokeratologie Interlens Nachtlinse Augenprobleme Sehpro
46 Lic. iur. Frank Brunner Brunner
5402
Baden
Advokatur und Notariat lic. iur. Frank Brunner 5402 Baden (Kanton Aargau Schweiz) ... Mellingerstrasse CH- Baden Telefon Tele Willkommen Suchen Sie Lösungen
brunneranwalt.ch Brunner Baden Frank Brunner Brunner Anwalt
47 Kovats zum scharfen Aug Kovats zum scharfen Aug AG Brille
5402
Baden
Kovats zum scharfen Aug Ihr Spezialist für Kontaktlinsen Brillen ... Rathausgasse CH- Baden + . + Suchen
binokularsehen.ch Brille Brillen Linsen Orthokeratologie Interlens Nachtlinse Augenprobleme Sehpro
48 Humbel Semela ? Rechtsanwälte
5402
Baden
... Semela Rechtsanwälte und Notare Zürcherstrasse Postfach Baden T + F +
hskanzlei.ch
49 Hebesa AG Hebesa Hebesa AG
5402
Baden
Seien Sie gewappnet für den Notfall und werden Sie zum Lebensretter. Wir sind Ihr Partner
hebesa.ch
50 Reform Beizen Lacke REFORM-Beizen & Lacke AG
5406
Baden-Rütihof

reform-beizen-lacke.ch
51 Elektronikbranche Schweiz
5406
Baden-Rütihof

elektronikbranche.ch
52 Marcel Danieli GmbH + Marcel Danieli GmbH Malergeschäft
5406
Baden-Rütihof
... Danieli Adresse Marcel Danieli GmbH Im Tobelacher Baden-Rütihof
marcel-danieli.ch Malergeschäft Rütihof Gesundes Wohnen Farbenfroh
53 Lehm Lehmverputz Tadelakt Geomantie naturfarben-malerei weber GmbH NaturfarbenMalere
5406
Baden-Rütihof
naturfarbenmalerei Pflanzenfarben Kalk Lehm Lehmputz Tadelakt Geomantie
naturfarben-malerei.ch NaturfarbenMalerei Naturfarbenmalerei Malen Malen Malerei Malerei Naturfarben Na
54 Rütihöfler Chronik Welcome
5406
Baden-Rütihof
... der Entwicklung ist absehbar denn freie Bauparzellen sind kaum mehr auszumachen. CH- ..
ruech.ch
55 KellerWeb_box
5406
Baden-Rütihof

rundume.ch
56 Trudydiserens.ch Bachblüten
5406
Baden-Rütihof
trudydiserens.ch trudydiserens.com Baden Aargau Mit der Tierkommunikation und dem anschliessenden Gespräch biete ich die
trudydiserens.ch Bachblüten Tierkommunikation Mediale Beratung Seminare
57 Rütihöfler Chronik Welcome
5406
Baden-Rütihof
... der Entwicklung ist absehbar denn freie Bauparzellen sind kaum mehr auszumachen. CH- ..
cgr.ch
58 Startseite Englisch
5406
Baden
Der Dito GmbH Verlag produziert Lehrbücher und Lernbücher für Englisch die für das Selbststudium
e-dito.ch Englisch Lernen Grammatik Vokabeln
59 Haustiersitting Willkommen Hunde
5406
Baden-Rütihof

haustiersitting.ch Hunde Katzen Maus Ratten
60 Zurück Ernährung
5406
Baden-Rütihof
Ernährungsberatung Seminare Weiterbildungen
esskunst.ch Ernährung Ernährungsberatung Ernährungsberaterin Zürich
61 Elektronikbranche Schweiz
5406
Baden-Rütihof

elektronik-branche.ch
62 Herzlich willkommen bei Weinereien
5401
Baden

weinereien.ch
63 Progressive Language Learning AG: Progressive Language Learning AG Sprachschule Spra
5401
Baden
Der Spezialist für Firmenkurse und Einzelntrainings Ihr Sprachtraining nach Mass überall und jeder
pll-sprachkurse.ch Sprachschule Sprachkurse Sprachtraining Sprachen Schule Lernen Company Firma Tra
64 Wohnen in der Sonnmatt Ambassador Immobilien und Verwaltungs AG
5401
Baden
... Mellingerstrasse Baden Minergie ist ein eingetragenes
wohnen-in-der-sonnmatt.ch
65 Chkp. Rechtsanwälte Notariat
5401
Baden

chkp.ch
67 Spalinger Planungsbüro
5401
Baden
... Planungsbüro für Haustechnik und Fachkoordination Zürcherstrasse Baden Tel
spalinger-ht.ch
68 Stieger Rechtsanwalt und Notar Rechtsanwalt
5401
Baden
... Bahnhofstrasse CH- Baden Telefon Tele mailstieger-law
stieger-law.ch Rechtsanwalt Notar Baden Anwaltskanzlei
69 Nova Investment Partners AG | Herzlich Nova
5401
Baden
Nova Investment Partners AG Anlageberatung Vermögensverwaltung Finanzdienstleistungen ... . September zum dritten ? months ago Bruggerstrasse Postfach Baden + +
investment-partners.ch Nova Investment Partners AG
70 Home Lions Club
5401
Baden
... . mehr>> Lions Club Baden-Heitersberg Schwertstrasse CH- Baden Mail Datenschutz
lcbh.ch
71 CAT Medien AG | CAT Medien AG
5401
Baden
Offizielle Webseite der CAT Medien aus Baden Schweiz
music-scene.ch
72 Pilatusplatz Schweiz-Immo AG Pilatusplatz
5401
Baden
Der Pilatusplatz mitten im pulsierenden Leben Luzerns wird ab Oktober 2006 ein neues
pilatusplatz.ch Pilatusplatz Luzern Architektur Geschäftshaus
73 Index.htm
5401
Baden

rus-ag.ch
74 Semiotictransfer Übersetzungsbüro für SemioticTransfer AG
5401
Baden
SemioticTransfer AG das Übersetzungsbüro die zertifizierte Kommunikationsagentur für Übersetzungen in alle Sprachen. Schweizer
semiotictransfer.ch
75 Küng Metzler; Rechtsanwältinnen
5401
Baden

rechtsanwaeltinnen.ch
76 Willkommen bei Serves Serves AG
5401
Baden

serves.ch
77   | Simona Hofmann
5401
Baden
... Talents Postfach CH- Baden Kontakt + managementsimonahofmann
simonahofmann.ch
78 Avadis: Home Avadis Vorsorge AG
5401
Baden

avadis.ch
79 Willkommen bei Charles Belaz Charles Bélaz AG Kaderselektion
5401
Baden

belazag.ch Kaderselektion Kadercoaching Kadertraining Zeitmanagement
80 Binder Rechtsanwälte: Home rechtsanwalt
5401
Baden
Binder Rechtsanwälte
binder-legal.ch Rechtsanwalt Recht
81 Home | BBP AG Financial BBP AG
5401
Baden
Für schnelle sichere Verbindungen zu SWIFT SIC euroSIC SECOM FED
bbp.ch
82 CAT Medien AG | CAT Medien AG
5401
Baden
Offizielle Webseite der CAT Medien aus Baden Schweiz
catmedien.ch
83 GeoProRegio | webplattform für geoProRegio AG
5401
Baden
... Über uns Newsletter Nutzungsbedingungen Kontakt Login geoProRegio AG Haselstrasse CH-
geoproregio.ch
84 Hausnet CAT Medien AG
5401
Baden

hausnet.ch
85 Fokussierte Zielgruppen für Ihre Insertas AG
5401
Baden
... und weltoffen. Das Wissensportal rund um Schweizer Traditionen Insertas AG Neuenhoferstrasse CH-
insertas.ch
86 Stiftung Langmatt Sidney Uhr
5401
Baden
... Museum Langmatt Stiftung Langmatt Sidney und Jenny Brown Römerstrasse ? CH- Baden Schweiz
langmatt.ch Uhr Sonntag Freitag Feiertag
87 Binder Rechtsanwälte: Home rechtsanwalt
5401
Baden
Binder Rechtsanwälte
advochannel.ch Rechtsanwalt Recht
89 Herzlich willkommen | Ambassador Immobilien und Immobilien und Verwaltungs AG ambassador
5401
Baden
Ambassador Immobilien und Verwaltungs AG aus 5400 Baden bietet Ihnen ein umfassendes Dienstleistungsangebot in allen ... Mellingerstrasse Baden mail ambassador-immo ch
ambassador-immo.ch Ambassador Baden Immobilien Verwaltung
90 50up.ch Insertas AG
5401
Baden

50up.ch
91 Aktuell | Kurtheater Baden
5401
Baden

kurtheater.ch
92 VOSER RECHTSANWÄLTE | Ihre Kanzlei
5401
Baden
VOSER RECHTSANWÄLTE erbringt umfassende Dienstleistungen bezüglich der rechtlichen Beratung und Vertretung von Unternehmen Privatpersonen ... Stadtturmstrasse CH- Baden + infovoser
voser.ch Kanzlei In Baden Aargau Anwälte
93 Binder Rechtsanwälte: Home rechtsanwalt
5401
Baden
Binder Rechtsanwälte
binder-partner.ch Rechtsanwalt Recht
94 CAT Medien AG | CAT Medien AG
5401
Baden
Offizielle Webseite der CAT Medien aus Baden Schweiz
content-cloud.ch
95 Well2you gesundheitlich und fianziell BEMER
5401
Baden
Aktive Gesundheitsförderung mit der BEMER Magnetfeldtherapie(Zellaktivierung) und Juice PLUS+ (Zellnahrung). Aktivierung grundlegender Stoffwechselvorgänge auf molekularer
well2you.ch BEMER Magnetfeldtherapie Zellaktivierung Gesundeheit Abnehmen
96 Wortgestalt
5401
Baden

wortgestalt.ch
97 Binder Rechtsanwälte: Home rechtsanwalt
5401
Baden
Binder Rechtsanwälte
swisslegalalliance.ch Rechtsanwalt Recht
98 CAT Medien AG | CAT Medien AG
5401
Baden
Offizielle Webseite der CAT Medien aus Baden Schweiz
kircheschweiz.ch
99 Binder Rechtsanwälte: Home rechtsanwalt
5401
Baden
Binder Rechtsanwälte
legalalliance.ch Rechtsanwalt Recht
100 Home LieberGott.ch CAT Medien AG
5401
Baden

liebergott.ch
101 CAT Medien AG | CAT Medien AG
5401
Baden
Offizielle Webseite der CAT Medien aus Baden Schweiz
lebens-buch.ch
102 Emmenegger Rechtsanwälte EMMENEGGER RECHTSANWÄLTE GMBH
5401
BADEN
... EMMENEGGER RECHTSANWÄLTE GMBH STADTTURMSTRASSE POSTFACH CH- BADEN TEL +
ce-rechtsanwaelte.ch
103 Gartenstadt WIDMI Willkommen Markstein AG Gartenstadt
5401
Baden
Die Gartenstadt Widmi in Lenzburg verkörpert höchsten Wohlfühlstandard. Modernster Wohnkomfort trifft auf generöse Freiräume. Stadtnahes
gartenstadt-widmi.ch Gartenstadt Widmi Bauen Eigentumswohnungen Immobilien
104 Asn.ch: ASN S&W Werbeagentur AG ASN
5401
Baden
Von der Krankenversicherung bis zur Lebensversicherung ASN bereitet Auswanderer optimal auf den Auslandaufenthalt vor und garantiert ... Bederstrasse CH- Zürich Schweiz T + infoasn Call us now Request a call back Contact
asn.ch ASN Entsendung Expatriates Expats
105 Starseite
5401
Baden
... für Sie Entfeuchter Center Shop.ch Whirli Shop Infos Kontakt Ausstellung und Verkauf Telefon
eu-preis.ch
106 Waschturmcenter.ch Waschturm
5401
Baden
Waschturmcenter.ch
waschturmcenter.ch Waschturm Waschtürme Siemens Bosch Miele Waschturmcenter Günstig Waschsäule
107 MarkenHaushaltsgeräte zu NettoPreisen| Kaufsignal.ch
5401
Baden
MarkenHaushaltsgeräte online kaufen: Bei Kaufsignal.ch erhalten Sie neben erstklassigen Produkten auch eine umfassende und kompetente ... für Sie Entfeuchter Center Shop.ch Whirli Shop Zahlen Sie bequem per Wir versenden mit Gerne halten
kochcenter.ch
108 Pcvisit Fernwartung für partekk handels ag desktopsharing
5408
ennetbaden
Fernwartung Online Support Desktop Sharing Lösungen von pcvisit. Bildschirminhalte schnell sicher ... Support Software auch für Schweizer Profis! Anschrift partekk handels ag badstrass a Ennetbaden
pcvisit-desktop-sharing.ch Desktopsharing Remote Pcvisit Fernwartung
109 Haus und Immobilien Lofthome Immobilien AG Immobilien
5408
Ennetbaden
Loft und Immobilien Zug Zürich Luzern Aargau. Ihr Immobilienmakler für Lofts ... Immobilien AG CH- Ennetbaden letzte Aktualisierung dieser Seite am ..
haus-basel.ch Immobilien Villen Lofts Zug
110 Creato Genossenschaft für
5408
Ennetbaden
... rights reserved powered by varinet creato Limmatauweg CH- Ennetbaden Telefon +
creato.ch
111 Immobilien Aargau Baden Wettingen Lofthome Immobilien AG Immobilien
5408
Ennetbaden
Immobilien Aargau Baden Wettingen Lenzburg Seengen Wohnungen Häuser Villen immobilienaargau.ch. Top Immobilienangebote
immobilienaargau.ch Immobilien Aargau Baden Wettingen Lenzburg Seengen
112 Kinderbetreuung Schweiz Kinderbetreuung
5408
Ennetbaden
Kantonale und regionale OnlineInformationen zur Kinderbetreuung in der Schweiz
kinderbetreuung-schweiz.ch Kinderbetreuung Babysitter Betreuungsplatz Kind
113 Immobilien Zürich Lofts Lofthome Immobilien AG Immobilien
5408
Ennetbaden
Immobilien Zürich Lofts Villen Bauernhäuser | loftzürich.ch |
loft-zurich.ch Immobilien Zürich Lofts Villen Bauernhäuser
114 Buckmanngewinnt.
5408
Ennetbaden

buckmanngewinnt.ch
115 SUNWORKS GMBH WE Sunworks GmbH SUNWORKS
5408
Ennetbaden
Seit der Gründung im Jahr 2000 plant implementiert und unterhält Sunworks IT Security Gesamtlösungen ... Sunworks GmbH Sonnenbergstrasse CH - Ennetbaden Phone + VoIP
sunworks.ch SUNWORKS PROTECT YOUR NET
116 Herzlich Willkommen auf unserer energieberatung
5408
Ennetbaden
Viele Haushalte bezahlen viel zu viel für Strom und Heizung. Das muss nicht sein.
energieundumwelt.ch Energieberatung Schweiz
117 Über uns
5408
Ennetbaden

stiftung-rosenau.ch
118 Home
5408
Ennetbaden
... Bachtalstrasse Ennetbaden Tel Diese -Adresse ist vor Spambots geschützt
svw-ag.ch
119 Badener Stadtwein Rebbau
5408
Ennetbaden

badenerstadtwein.ch
120 ImmoGuidi Startseite
5408
Ennetbaden
Wir orientieren uns nach Ihren individuellen Beduuml;rfnissen. Daher erarbeiten wir Louml;sungen die Ihren langfristigen
immoguidi.ch
121 Tagesstrukturen Ennetbaden | Home Tagesstrukturen
5408
Ennetbaden
Wir ergänzen die Betreuung der Kinder ersetzen aber weder die Familie noch die Schule. ... im Mutterschaftsurlaub und wird von Manuela Grod vertreten. Tagesstrukturen EnnetbadenGeissbergstr. Ennetbaden
tagesstrukturen-ennetbaden.ch Tagesstrukturen Ennetbaden Kita Betreuungsplatz
122 Indian Restaurant Tajmahal restaurant
5408
Ennetbaden
restaurant in switzerland indian restaurant chicken kebab in switzerland baden ennetbaden
tajmahal-baden.ch Restaurant In Switzerland Indian Restaurant Chicken
123 LoMaCo Cosmetic Das Kosmetik
5408
Ennetbaden
LoMaCo das Kosmetikstudio im Raum Baden / Ennetbaden. Kommen Sie zu uns für Kosmetik ... Turgi Terramagica LoMaCo Cosmetic Sonnenbergstrasse Ennetbaden infolomaco
lomaco-cosmetic.ch Kosmetik Wimpernverlängerung Wimpernschulung Shellac
124 Lofts Immobilien Lofthome Immobilien AG loft
5408
Ennetbaden
Lofts Immobilien WIR Shop exklusive Automobile. Zug Zürich Aargau Luzern ... jetzt online - Lofthome AG WIR-Shop Immobilien Automobile Ennetbaden
lofthome.ch Loft Immobilien Verkauf Zug Zuerich Aargau Luzern Wir
125 _mpj
5408
Ennetbaden

mpj.ch
126 Nörbs Locher Roadie noerbus
5408
Ennetbaden
Nouml;rbs Locher Roadie amp; Driver Services Ehrendingerstrasse 57 5408 Ennetbaden ... Ehrendingerstrasse Ennetbaden ...... eine band mit equipment ...... ...... ein fahrzeug unterwegs
noerbus.ch Noerbus Nörbs Locher Roadie
127 Samariterverein Oerlikon und Umgebung
5408
Ennetbaden

oerlikon-samariter.ch
128 Home Yoga
5408
Ennetbaden
YogaUnterricht YogaKurse und YogaWorkshops in Baden und Kirchdorf mit Barbara Dehm in ruhiger
musikundyoga.ch Yoga Baden YogaKirchdorf YogaUnterricht Yogaschule
129 Parkhäuser | www.parking.ch 012 GmbH
5408
Ennetbaden
... von Dienstleistungen und fördern und beteiligen uns an Innovationen. GmbH Rebbergstrasse
parking.ch
130 Home
5408
Ennetbaden

rotberg-musikanten.ch
131 Samariterverein Oerlikon und Umgebung
5408
Ennetbaden

samariter-oerlikon.ch
132 Prosenio – zu Hause
5408
Ennetbaden
... Bethesda Alterszentren Badstrasse Ennetbaden info.prosenio
prosenio.ch
133 Rbvnow.ch | Renata B. Renata
5408
Ennetbaden bei Zürich
Willkommen bei Renata B. Vogelsang Ihr Anliegen steht im Mittelpunkt! Ich gebe Ihnen Impulse
rbv-now.ch Renata B. Vogelsang
134 Temaco AG ? Ihr Temaco AG
5408
Ennetbaden
... weiter als Berater zur Verfügung. FANAIR AG Lager- und Betriebseinrichtungen Grossmatt Rain CH- Rudolfstetten
temaco-ag.ch
135 Ssaapp
5408
Ennetbaden

ssa-app.ch
136 Shiatsuerleben.ch
5408
Ennetbaden

shiatsuerleben.ch
137 BluEDGE Service Management bluEDGE Methodik GmbH bluEDGE
5408
Ennetbaden
bluEDGE ist spezialisiert auf die Bewältigung der täglichen Herausforderungen im Service Management. ... kontaktbluedge tel + bluEGDE Methodik GmbH Sonnenbergstrasse
bluedge.ch BluEDGE Methodik Methode Service Management
138 Badenerfasnacht Home Fasnacht
5408
Ennetbaden
Website mit allen Infos rund um die Badenerfasnacht
badenerfasnacht.ch Fasnacht Baden Maske Schnitzebank
139 Dschinni The personal dschinni
5408
Ennetbaden
Web design and architectural visualisation portfolio of André Vock A web designer who shows
dschinni.ch Dschinni Personal Online Portfolio
140 FTV Ennetbaden Startseite Turnverein
5408
Ennetbaden
Der FTV Ennetbaden ist ein Turnverein für Frauen ab 40: Gymnastik Dehnung Übungen
ftv-ennetbaden.ch Turnverein Frauen Ennetbaden Gymnastik
141 IJOY iJoy
5408
Ennetbaden
IJOY Massagesessel
ijoy.ch IJoy Massage Chair Human Touch 130 175 2720
142 Naturheilpraxis und Kinesiologie in Naturheilpraxis
5408
Ennetbaden
Naturheilpraxis und Kinesiologie in Baden Renate Erni Gesundheitspraxis Praxis für Kinesiologie
heiltherapie.ch Naturheilpraxis Und Kinesiologie In Baden Heiltherapie
143 Herzlich willkommen | Panorama Hertenstein Panorama Restaurant AG Hertenstein
5408
Ennetbaden
Herzlich Willkommen im Hertenstein Panorama Restaurant in Ennetbaden. Hoch über Baden mit traumhafter Aussicht bieten ... Restaurant Hertensteinstrasse Ennetbaden Kontakt . info
hertenstein.ch Hertenstein Restaurant Panorama Dining 5408 Ennetbaden Bankette Essen
144 Prosenio – zu Hause
5408
Ennetbaden
... Bethesda Alterszentren Badstrasse Ennetbaden info.prosenio
vereinnational.ch
145 Visions sud est
5408
Ennetbaden
The Swiss fund visions sud est was initiated by the Foundation trigonfilm Baden and the
visionssudest.ch
146 Babyswiss baby
5408
Ennetbaden
baby
babyswiss.ch Baby
147 Walter Egli und Partner wepartner
5408
Ennetbaden
Walter Egli und Partner GmbH Ennetbaden Planung Bauleitung und/oder Vermittlung von Einfamilienhäusern ... EFH Lengnau Offene Stellen Kontakt Baumanagement Rebbergstrasse Ennetbaden
wepartner.ch Wepartner Wepartner.ch Www.wepartner.ch Bauberatung
148 Yogabaden in Ennetbaden bei Yoga
5408
Ennetbaden bei Zürich
yogabaden ein Ort an dem Sie sich von Anfang an wohlfühlen werden. Das bestätigen
yoga-baden.ch Yoga Baden Wettingen Ennetbaden
149 Massagesesselshop.ch Massagesesselshop
5408
Ennetbaden
Massagesesselshop Massagesessel Sanyo DR 8700 Panasonic Yasumi Yuvassage
yuva.ch Massagesesselshop Massagesessel Sanyo DR 8700 Panasonic Yasumi Yuvassage
150 Samariterverein Oerlikon und Umgebung
5408
Ennetbaden

samariter-zuerinord.ch
151 LoMaCo Cosmetic Das Kosmetik
5408
Ennetbaden
LoMaCo das Kosmetikstudio im Raum Baden / Ennetbaden. Kommen Sie zu uns für Kosmetik ... Turgi Terramagica LoMaCo Cosmetic Sonnenbergstrasse Ennetbaden infolomaco
lomaco.ch Kosmetik Wimpernverlängerung Wimpernschulung Shellac
152 Massagesesselshop Schweiz Massagesesselshop
5408
Ennetbaden
Massagesesselshop Schweiz Massagesessel Sanyo DR 8700 Panasonic Yasumi Yuvassage
massagesesselshop.ch Massagesesselshop Schweiz Massagesessel Sanyo DR 8700 Panasonic Yasumi
153 Angora Import Switzerland Angora
5408
Ennetbaden
Angora Schweiz
angorashop.ch Angora Kinderkleider Fraue Männer Unterwäsche
154 Lebensberatung Editha Meier Lebensberatung
5408
Ennetbaden
Lebensberatung Editha Meier
editha.ch Lebensberatung Editha Meier
155 Home « Gähler und Gähler und Partner AG Planen
5408
Ennetbaden
Erfolgreich planen. Als Generalplanungsunternehmen bieten wir ein umfassendes Dienstleistungsspektrum im Hochbau Untertag und Tiefbau ... ERFOLGREICH PLANEN Gähler und Partner AG Sonnenbergstrasse CH- Ennetbaden Tel +
generalplanung.ch Planen Bauen Infrastrukturbau Untertagbau Strassenbau Bahnbau Konstruktiver Inge
156 Fussmattemitlogo.ch Fussmatte
5408
CH-Ennetbaden
Fussmatte mit Logo Logomatten Türmatte Fussmattenshop
fussmattenshop.ch Fussmatte Mit Logo Name Logomatte Matte Fussmattenshop
157 SKN für Hundehaltende SKN
5408
Ennetbaden
Sachkundenachweis Theorie und Praxis für Hundehalter ... Grendelstrasse Ennetbaden Telefon + Mobile + infoskn
clicker-training.ch SKN Für Hundehalter
158 Genossenschaft Bühne Heimat
5408
Ennetbaden

gnossi-heimat.ch
159 Agentur für visuelle Kommunikation fontijn enderli gmbh
5408
Ennetbaden
Agentur für visuelle Kommunikation ... Schliessen fontijn enderli gmbh Ehrendingerstrasse Ennetbaden + infofe
fe-agentur.ch
160 Grendel Immobilien AG Grendel Immobilien AG Stichwörter
5408
Ennetbaden
Beschreibung ... Immobilien AG Sonnenbergstrasse CH--Ennetbaden T + Standort
grendel-immobilien.ch Stichwörter
161 Naehcoach.ch Page 1. naehen
5408
Ennetbaden
Coach für alle Nähfragen
naehcoach.ch Naehen Nähen Nähmaschine Naehmaschine
162 Shaba Baden ? Liliane's shaba
5408
Ennetbaden
Willkommen bei Shaba Baden. Lassen Sie sich bei Liliane Jaun mit der Shaba Methode sanft
shaba-baden.ch Shaba Baden Haarentfernung Zuckergel
163 Schminkperle Home
5408
Ennetbaden
... . Geissbergstrasse . Ennetbaden . + . >>> Bitte JavaScript aktivieren um die -Adresse
schminkperle.ch
164 Home « Gähler und Gähler und Partner AG Gähler
5408
Ennetbaden
Gähler und Partner AG ist das grösste Generalplanungsunternehmen im Kanton Aargau. Das Dienstleistungsspektrum umfasst Hochbau ... Gähler und Partner AG Sonnenbergstrasse CH- Ennetbaden Tel + info
gpag.ch Gähler Und Partner AG Generalplanungsunternehmen Hochbau
165 Naturheilpraxis und Kinesiologie in Naturheilpraxis
5408
Ennetbaden
Naturheilpraxis und Kinesiologie in Baden Renate Erni Gesundheitspraxis Praxis für Kinesiologie
heil-therapie.ch Naturheilpraxis Und Kinesiologie In Baden Heiltherapie
166 Willkommen bei Schneckenzaun.ch Soba Inter AG
5405
Baden - Dättwil

schneckenzaun.ch
167 Home Fritac Medizintechnik Fritac Medizintechnik AG
5405
Baden
... ADRESSE Fritac Medizintechnik AG Täfernstrasse A CH- Baden info
fritac.ch
168 Herzlich Willkommen bei InnerCare.ch geist
5405
Baden-Dättwi
Neue Kraft und Energie für Körper und Geist testen Sie unser vielseitiges Angebot. Wir ... - Baden-Dättwil - Webseite erstellen lassen idee --> technische umgebung
inner-care.ch Geist Körper Seele Gesundheit
169 Produkte für Ihre IT
5405
Baden
... Sommerhaldenstrasse CH- Baden F in Muri Bachstrasse CH- Muri F Informatik GmbH ? AGB ?
f12-informatik.ch
170 Avisec Videoüberwachung Systeme avisec ag
5405
Remetschwil

avisec.ch
171 Home Chizentrum Gesundheit
5405
Dättwil-Baden
Meggi Pinzon Gesundheit und Fitness med. Massagen Training mit smovey Vibrorings ... - Webdesign Giel Badstrasse CH Rietheim mail infogiel
chizentrum.ch Gesundheit Wellness Fitness Agape
172 City com baden
5405
Baden-Dättwil

citycombaden.ch
173 SCHILLING BAU AG Baden SCHILLING BAU AG
5405
BADEN-DÄTTWIL

schilling-bau.ch
174 Pintedaettwil.ch Home Pinte Dättwil AG Pinte
5405
Baden - Dättwil
Pinte Dättwil In den traditionellen Räumlichkeiten mit einem Hauch französischer Brasserie begrüssen wir Sie schon
pinte-daettwil.ch Pinte Dättwil Pinte Dättwil Speisen
175 Kosmetikfarbart
5405
Dättwil

artofaesthetics.ch
176 Prachtfarben.ch kunstkarten
5405
Baden -Dättwil
Prachtfarben.ch
prachtfarben.ch Kunstkarten Heilung Bilder Farben
177 Websitecheck | Webanalyse BlueMouse GmbH Webanalyse
5405
Dättwil AG
Wir analysieren Ihre Website zu Pauschalpreisen.
websitecheck.ch Webanalyse Usability Website
178 Beldona Beldona AG Dessous
5405
Baden
Dessous Bademode Home und Beachwear Tag und Nachtwäsche
beldona.ch Dessous Bademode Homewear Beachwear
179 Confiserie Michel AG · Confiserie Michel AG Süsswaren
5405
Baden-Dättwil
Confiserie Michel AG Partner für exklusive Süsswaren und Geschenkartikel. Wir bieten ein breites
confiseriemichel.ch Süsswaren Exklusive Süsswaren Fruchtgummi Zuckerwaren
180 Feldenkrais Baden Feldenkrais Feldenkrais
5405
Dättwil
Feldenkrais ist eine Lernmethode deren Ziel es ist neue Verbindungen im Gehirn herzustellen
feldenkrais-bewegt.ch Feldenkrais Baden Feldenkrais Dättwil Coaching
181 Fittefuesse Fusspflege und Dipl.
5405
Baden-Dättwil
Fusspflege thailändische Fussmassage und Wellness für die Füsse in Baden Dättwil. ... ? Baden-Dättwil Mobil
fittefuesse.ch Dipl. Fusspflegerin Fusspflege Thailändische Fussmassage
182 Home TaBa Tagesbetreuung
5405
Dättwil
Tagesbetreuung Kinderbetreuung und Mittagstisch für Kinder in Baden ? familienergänzende Betreuung in den Quartieren
ta-ba.ch Tagesbetreuung Kinderbetreuung Mittagstisch Baden
183 Klimaanlagen für ein gutes Subag Tech AG klimaanlagen
5405
Baden-Dättwil
SubagTech führt sämtliche Geräte um die Raumluft zu kühlen zu befeuchten zu trocknen ... für Sie da. Beratungsgespräch Stunden Pikett Wartung Service SUBAG TECH AG - Täfernstrasse - Baden Dättwil -
subag-tech.ch Klimaanlagen
184 SumIT get value sumIT
5405
Baden-Dättwil
sumIT get value from data ... Sie uns an sumIT AG Täfernstrasse Baden-Dättwil Fon Diese
sumit.ch SumIT Oracle Warehouse Builder 10g BI DWH
185 Wrigley.ch Willkommen bei
5405
Baden-Dättwil
Willkommen bei Wrigley Schweiz
wrigley.ch
186 Startseite
5405
Baden-Dättwil
... Gemeinschaftspraxis für Naturheilkunde Husmatt Husmatt Baden-Dättwil infomanal-ciurlia
manal-agha.ch
187 AP Dialog | Telemarketing AP Dialog GmbH
5405
Baden-Dättwil
AP Dialog ist eine junge Schweizer Telemarketing Firma. Wir unterstützen Sie als Dienstleister bei Telemarekting
apdialog.ch
188 Monika Sutter | Treuhand monika
5405
Baden-Dättwil
Monika Sutter begleitet kleinere und mittlere Unternehmungen als Beraterin und Vertrauensperson in den Bereichen Treuhand
mos-treuhand.ch Monika Sutter Ms Treuhand Treuhand Treuhandexpertin Buchhaltung Finanzen
189 Natural Beauty Ruth Natural
5405
Baden-Dättwil
Natural Beauty Ruth Villiger Kosemetik Schönheit Hautpflege Gesundheit Wellness ... zur Startseite ] Zurück zum Seitenanfang NATURAL BEAUTY Beratung und Kontakt Ruth Villiger Im Langacker CH
naturalbeauty.ch Natural Beauty Ruth Villiger Kosemetik
190 Orbit Gum Orbit
5405
Baden-Dättwil

orbit-gum.ch
191 Finden Sie den richtigen Vianor AG
5405
Baden
Nokian Tyres Reifen für anspruchsvolle Sommerverhältnisse vom Erfinder des ersten Winterreifens.
nokiantyres.ch
192 Home Moto 69 GmbH Moto
5405
Baden-Dättwil
Bei Moto 69 GmbH stehen Sie als Kunde im Vordergrund. Kundennah flexibel und ... Heimgartner Oberrohrdorferstr. c CH- Baden-Dättwil Telefon Tele
moto69.ch Moto 69 GmbH Moto 69 GmbH
193 More than fitness » KraftAusdauer
5405
Dättwil bei Baden AG
Phoenix Fitness Dättwil Baden modernes Fitnesscenter für Einsteiger und Fortgeschrittene KraftAusdauer Groupfitness ... . WEGBESCHREIBUNG Fitnesscenter Phoenix Täfernstrasse CH- Dättwil AG Schweiz Tel Mail
phoenixfitness.ch KraftAusdauer Groupfitness Myride+ Spinning
194 Home Physiotherapie
5405
Baden-Dättwil
... für Physiotherapie Heike Uhlir Husmatt Baden-Dättwil Webdesign by Midnight Media GmbH
physio-praxis.ch Physiotherapie Physio PhysioTherapie Heike Uhlir
195 Pbooking.ch pbooking
5405
baden ag - dättwil
In einem Zeitalter in dem eine Reise online zu buchen oder eine Pizza online
p-booking.ch Pbooking Kunden Bieten Restaurantbetrieb
196 Pdev.ch programmierung
5405
baden ag - dättwil

p-dev.ch Programmierung Applikationen Standards Webseiten
197 Pjoomla.ch joomla
5405
baden ag - dättwil
 
p-joomla.ch Joomla Cms Anwender Erweiterungen
198 Pmedia.ch marketing
5405
baden ag - dättwil

p-media.ch Marketing Design Website Webdesign
199 Pkit.ch pkit
5405
baden ag - dättwil
Der pKit Baukasten ermöglicht uns in windeseile für Sie zugeschnittene Webapplikationen umzusetzen. Damit möchten wir
p-kit.ch Pkit Outlook Excel Export
200 Preport.ch crystal
5405
baden ag - dättwil
 
p-report.ch Crystal Reports Applikationen Net
201 Pschool.ch erfüllung
5405
baden ag - dättwil
pschool. ch Lernen einfach gemacht!
p-school.ch Erfüllung Optimalste Lernziele Prüfungen
202 Ptech.ch systeme
5405
baden ag - dättwil
Die moderne EDV ist hilfreich und nicht selten nervenaufreibend. Ob Fehlermeldung Totalausfall oder Datenverlust
p-tech.ch Systeme Sicherer Effektiver Ziele
203 Pcon.ch weiterentwicklung
5405
baden ag - dättwil
pcon ist ein junges Unternehmen in Baden AG das dem Schweizer IT Markt
pcon.ch Weiterentwicklung Beratung Pcon Gewährleisten
204 Inter Grund AG Inter Grund AG Inter
5405
Baden-Dättwil
... Home Kontakt Standort Gruppe Suchen Login Inter Grund AG Im Grund Baden-Dättwil
intergrund.ch Inter Grund AG
205 SCHILLING LOGISTIK AG SCHILLING Logistik AG
5405
Baden-Dättwil

schilling-logistik.ch
206 Schlosshalde.ch PRIVERA AG Lenzburg
5405
Baden-Dättwil
Noch wenige 3.5 und 4.5ZimmerWohnungen per sofort zu vermieten an der Neuhofstrasse in Lenzburg
schlosshalde.ch Lenzburg Baden Brugg Aarau
207 Home Daniel Brunner Schulung & Training GmbH Dani
5405
Baden-Dättwil
Dani Brunner Schulung Training Fühung ... will sollte immer die Sache nie aber den Menschen in den Mittelpunkt stellen. (Führungsprinzipien nach Ch. Blocher
schulung-training.ch Dani Brunner Schulung Training Fühung
208 Pschool.ch erfüllung
5405
baden ag - dättwil
pschool. ch Lernen einfach gemacht!
pschool.ch Erfüllung Optimalste Lernziele Prüfungen
209 Zeka Zentren körperbehinderte
5405
Baden-Dättwil

ristoro.ch
210 Rioxo® HD over barox Kommunikation AG rioxo®
5405
Baden-Dättwil
rioxo® HD over IP HD Lösung auf IP HDVideo HD video ... in den anderen vom Entwicklungslabor ins Auditorium und von der Generalversammlung in den Presseraum. rioxo GmbH Im Grund CH
rioxo.ch Rioxo® Barox
211 ISports AG: Fitnessgeräte i-sports AG fitnessgeraete
5405
Dättwil-Baden
iSports AG Import und Vertrieb von Fitnessgeräten. Fit for Life
tunturi-shop.ch Fitnessgeraete Fitnessgeräte Crosstrainer Laufband
212 TopTrading
5405
Baden-Dättwil

top-trading.ch
213 Brunnenbau Conrad Anything Brunnenbau Conrad Schweiz GmbH Brunnenbau
5405
Baden-Dättwil

brunnenbau-conrad.ch Brunnenbau Conrad Matthias Conrad Wasserhaltung
214 Azur Baugenossenschaft Divor AG Azur
5405
Dättwil
Die Baugenossenschaft Azur Das erprobte SeniorenwohnungsKonzept für Gemeinden. Gemeinnützige Seniorenwohnungen für mehr Selbstständigkeit und ... und Lebensfreude. Divor AG Täfernstrasse Dättwil www.divor SADA AG Widenholzstrasse
bgazur.ch Azur Baugenossenschaft Seniorenwohnung Wohnen Im
215 Bergauer AG Leit Bergauer AG Verkehrsmanagemen
5405
Baden-Dättwil
Bergauer entwickelt und realisiert Leit und Steuersysteme für das Verkehrsmanagement die Industrie Gebäudetechnik
bergauer.ch Verkehrsmanagement Signalanlagenbau Steuersystem Leitsystem
216 Home Baregg
5405
Baden-Dättwil
Baregg Badminton Baden Plausch Interclub
bcbaregg.ch Baregg Badminton Baden Plausch
217 Home » MPI Distribution AG MPI Distribution AG MPI
5405
Dättwil
MPI Distribution AG ... holders. MPI Distribution AG Täfernstrasse CH- Dättwil
mpi.ch MPI Distribution AG Dättwil
218 VoIP / Internettelefonie | Winet Network Solutions AG
5405
Baden-Dättwil
... . Home AGB Kontakt Sitemap myPhone Login Winet Network Solutions AG Täfernstrasse CH-
winet.ch
219 Willkommen im bünzmärt Wohlen PRIVERA AG buenzmaert
5405
Baden-Dättwil
Willkommen im bünzmärt in Wohlen. Attraktive Laden und Gewerbeflächen zu vermieten!
buenz-maert.ch Buenzmaert Bünzmärt Bünz Wohlen
220 Home Schmid Innendekoration GmbH Teppiche
5405
Dättwil
Innendekoration Schmid Innendekoration GmbH nicht nur Teppiche...
danischmid.ch Teppiche Parkett Laminat PVC
221 Willkommen bei DiaMon |
5405
Baden-Dättwil
... Mellingerstrasse Baden-Dättwil Telefon Tele
diamon.ch
222 Home Kernkompetenz ist Crenova Renovationen AG
5405
Baden-Dättwil
Kernkompetenz der Crenova Renovationen AG ist die Sanierung und die Renovation von Altliegenschaften. Die Crenova ... Täfernstrasse Baden-Dättwil infocrenova Tel + +
crenova.ch
223 Home Domedics AG Domedics AG
5405
Dättwil

domedics.ch
224 Kaffee der Kafferösterei P. P. Graf Kaffeerösterei AG kaffee
5405
Baden-Dättwil
Die P. Graf Kaffeerösterei AG in BadenDättwil hat sich auf Herstellung und Verteilung von hochwertigem
graf-kaffee.ch Kaffee Kaffeerösterei
225 HTHolding AG HT-Holding AG Rudolf
5405
Baden-Daettwil
HTHolding AG HighTech Made in Switzerland
ht-holding.ch Rudolf Hug Hug Verwaltungsrat
226 IGDaettwil IGDättwil
5405
Baden-Dättwil
IGDättwil wo Baden boomt! Interessengemeinschaft für Unternehmen in Dättwil. ... Sekretariat IG "Dättwil ? wo Baden boomt" Im Grund Baden-Dättwil Telefon
ig-daettwil.ch IGDättwil Dättwil Baden Boomt Firmen
227 ISports AG: Fitnessgeräte i-sports AG fitnessgeraete
5405
Dättwil-Baden
iSports AG Import und Vertrieb von Fitnessgeräten. Fit for Life
i-sports.ch Fitnessgeraete Fitnessgeräte Crosstrainer Laufband
228 IBAKH IBAKH
5405
Baden-Dättwil
Home Page
ibakh.ch IBAKH Engineering Services Advisory
229 HELIOS Holziken PRIVERA AG
5405
Baden-Dättwil
Helios Holziken ... auf. PRIVERA AG Frau Tamara Arpagaus Täfernstrasse Baden-Dättwil Telefon +
helios-holziken.ch
230 Beratung gabriele stemmer obrist evaluation
5405
Baden-Dättwil
Evaluation Beratung Entwicklung und Coaching bei Gabriele Stemmer Obrist BadenDättwil ... Im Langacker Baden-Dättwil infoebec-stemmer
ebec-stemmer.ch Evaluation Beratung Entwicklung Coaching
232 ExePro AG ExePro AG
5405
Baden-Dättwil
Executives Professionals Search Wir suchen und vermitteln Fachspezialisten und Führungskräfte schweizweit.
exepro.ch
233 HEBES HeimBenchmarking | Für Keller Unternehmensberatung AG Benchmarking
5405
Baden-Dättwil
Benchmarking für Alterszentren Pflegezentrum und andere Heime oder Langzeitinstitutionene ... Täfernstrasse CH- Baden-Dättwil + info - at - hebes Benchmarking Aufbau HEBES
hebes.ch Benchmarking Alterszentren Altersheime Pflegezentren
234 Hilpert Schweiz Herzlich Hilpert Electronics AG
5405
Baden-Dättwil
Hilpert electronics ist Ihr zuverlässiger Partner für Beratung FertigungsEquipement und Verbrauchsmaterial in der ... Electronics AG Täfernstrasse CH- Baden-Dättwil + .+ Mail office
hilpert.ch
235 HMS Media Service AG HMS Media Service AG
5405
Baden-Dättwil

hms-media.ch
236 Herzog Kull Group ?
5405
Baden

hkg.ch
237 Home HEUREKA Gamma AG
5405
Baden-Dättwil

heureka-gamma.ch
238 Home ?agentur mehrwert
5405
baden
... mehrwert agentur für bewusstes marketing zelgweg baden t + f +
agentur-mehrwert.ch
239 AKTIVGROUP HOME Treuhanddienstleistungen Treuhanddienstlei
5405
Dättwil AG
AKTIVGROUP: Wir unterstützen Sie aktiv in allen kaufmännischen und treuhänderischen Belangen welche für das
aktiv-group.ch Treuhanddienstleistung Treuhanddienstleistung Treuhanddienstleistung Finanzco
240 Sabag Vielfältig kompetent SABAG BAUKERAMIK AG Küchen
5405
Baden-Dättwil
Ihr Spezialist für Küchen Bäder Baukeramik Baumaterial Holz Bedachung
sabag.ch Küchen Bäder Baukeramik Baumaterial
241 Herzlich willkommen | Ärztezentrum
5405
Baden-Dättwil
... . med. U. Geissendörfer Pract. med. A. Hübecker Dr. med. M. Kiener Dr. med. Ch. Löschhorn Dr. med. L
aerztezentrum-taefernhof.ch
242 Home Wrigley's Airwaves
5405
Baden-Dättwil

airwaves.ch
243 Jessica's Art Gallery antolini
5405
Dättwil
Jessica's Art Gallery
antolini.ch Antolini Acryl Bilder Kunst
244 7P smit Consulting
5405
Baden-Dättwil
HLB
7psmit.ch
245 Willkommen beim
5405
Dättwil
... Broder - VisionCentre - Täfernstrasse a - Dättwil -
visioncentre.ch
246 Home von Tobel AG heizung
5405
Baden-Dättwil
1942 gründete Ernst von Tobel in Baden ein Fachgeschäft das sich auf sanitäre Anlagen ... Baden-Dättwil Telefon infovon-tobel
von-tobel.ch Heizung Sanitär Vontobel Baden
247 ISports AG: Fitnessgeräte i-sports AG fitnessgeraete
5405
Dättwil-Baden
iSports AG Import und Vertrieb von Fitnessgeräten. Fit for Life
bremshey-shop.ch Fitnessgeraete Fitnessgeräte Crosstrainer Laufband
248 Home Compasell GmbH
5405
Baden-Dättwil

compasell.ch
249 Regula Dell'AnnoDoppler am 22. regula
5405
Baden-Dättwil
Hier finden Sie Informationen über Person Engagement und Ziele.
regula-dellanno.ch Regula Dell'annodoppler Stadtrat Baden September
250 Startseite P12 Medical GmbH
5405
Baden

d8xanto.ch
251 Crystalreports.ch crystal
5405
baden ag - dättwil
 
crystal-reports.ch Crystal Reports Applikationen Net
252 Homepage | Crossfit Baden
5405
Baden-Dättwil
Crossfit Baden
crossfitbaden.ch
253 Aspecto :: aspecto.ch :: Aspecto GmbH
5405
Baden
... Follow us Contact Aspecto GmbH Täfernstrasse Baden Switzerland + . +
aspecto.ch
254 Home page Weber Saint-Gobain Weber AG Marmoran
5405
Dättwil AG
Marmoran; seit über 50 Jahren das Original und die Nummer 1. Es gibt keine Alternative! ... der Wirtschaft mit einem Zertifikat augezeichnet. weber CH App // Neu weber CH App für i-Phone
weber-marmoran.ch Marmoran Maxit Favo KBS
255 ZahnOase Dättwil günstige ZahnImplantate Dr.med.dent. Bernd Kessler & Partner Implantate
5405
Baden-Dättwil
ZahnOase Dättwil: Feste Zähne mit Hilfe von Implantaten. Zahnimplantate schmerzfrei ohne Chirurgie zu günstigen Preisen. ... . dent. Bernd Kessler Partner Mellinger CH- Baden-Dättwil -
zahn-oase.ch Implantate Zahnimplantate Zahn Arzt
256 Zeka Zentren körperbehinderte
5405
Baden-Dättwil

zeka-ag.ch
257 Www.steinmagie.ch Magie der Sternzeichen
5405
Dättwil
Interessantes und Wissenswertes über die Magie Kraft und Schönheit der Steine.
steinmagie.ch Sternzeichen Kraft Stein Edelstein Weisheit Mineralien Wirkung Natur
258 Startseite RHEINZINK (Schweiz) AG Titanzink
5405
Baden-Dättwil
Auf dieser Startseite von RHEINZINK erhalten Sie umfassende Informationen über Metalldachdeckungen Fassadenbekleidungen und Dachentwässerungen
rheinzink.ch Titanzink Zink Zinklegierungen Metalldach
259 Www.side4you.ch side4you
5405
Dättwil
Wir erstellen installierbare Softwareanwendungen Hompages individuell für Ihr Unternehmen
side4you.ch Side4you Analyse Design Programmierung
260 Sabag Vielfältig kompetent SABAG BAUKERAMIK AG Küchen
5405
Baden-Dättwil
Ihr Spezialist für Küchen Bäder Baukeramik Baumaterial Holz Bedachung
stahlcenter.ch Küchen Bäder Baukeramik Baumaterial
261 Imatom GmbH Baden Schweiz Imatom GmbH
5405
Baden
... . Wichtige Links Bestellformular Rücknahme von Altquellen ISO-Zertifikat Imatom GmbH Täfernstrasse a CH
imatom.ch
262 Startseite: Vin Media Vin Media GMBH Vin
5405
Dättwil AG

vinmedia.ch Vin Media
263 Sabag Vielfältig kompetent SABAG Baukeramik AG Küchen
5405
Baden-Dättwil
Ihr Spezialist für Küchen Bäder Baukeramik Baumaterial Holz Bedachung
sabella.ch Küchen Bäder Baukeramik Baumaterial
264 Pdev.ch programmierung
5405
baden ag - dättwil

pdev.ch Programmierung Applikationen Standards Webseiten
265 Home Physiotherapie
5405
Baden-Dättwil
... für Physiotherapie Heike Uhlir Husmatt Baden-Dättwil Webdesign by Midnight Media GmbH
physio-baregg.ch Physiotherapie Physio PhysioTherapie Heike Uhlir
266 Pmedia.ch marketing
5405
baden ag - dättwil

pmedia.ch Marketing Design Website Webdesign
267 Pjoomla.ch joomla
5405
baden ag - dättwil
 
pjoomla.ch Joomla Cms Anwender Erweiterungen
268 HOME ginafinas Webseite!
5405
Baden-Dättwil
... World Baregg Zelgweg Baden-Dättwil + infoginafina Öffnungszeiten Montag
ginafina.ch
269 Pcms.ch joomla
5405
baden ag - dättwil
 
p-cms.ch Joomla Cms Anwender Erweiterungen
270 Pbooking.ch pbooking
5405
baden ag - dättwil
In einem Zeitalter in dem eine Reise online zu buchen oder eine Pizza online
pbooking.ch Pbooking Kunden Bieten Restaurantbetrieb
271 Ptech.ch systeme
5405
baden ag - dättwil
Die moderne EDV ist hilfreich und nicht selten nervenaufreibend. Ob Fehlermeldung Totalausfall oder Datenverlust
ptech.ch Systeme Sicherer Effektiver Ziele
272 Burger Industry Consulting for Burger Industry Consulting GmbH Industrieberatung
5405
Baden-Dättwil
Industrieberatung für Verpackungstechnik und Produktionslogistik ? branchenübergreifendes KnowHow? zielgerichtete und nachhaltige Lösungen? für Süsswaren wie
binco.ch Industrieberatung Verpackungstechnik Verpackung Technik
273 BAUline Handel AG BAU-line Handel AG Baumaterialien
5405
Dättwil
Wie bieten Ihnen alles rund um den Bau und überzeugen mit qualitativ hochstehenden Produkten.
bau-line.ch Baumaterialien Baumaterial Maschienen Maschiene
274 Startseite Buchmax Buchshop Dornbusch Medien AG Buchshop
5405
Baden-Dättwil
Entdecken Sie unsere von Experten ausgesuchten Bücher und Filme auf buchmax.ch dem speziellen Büchershop
buchmax.ch Buchshop Buchladen Bücher Stöbern Buchempfehlung
275 Homepage | Crossfit Aarau CrossFit Baden GmbH
5405
Baden-Dättwil
Crossfit Baden
crossfitaarau.ch
276 Atelier Bauplanung Home
5405
Dättwil
... Atelier Bauplanung infoatelier-bauplanung Pilgerstrasse Dättwil Suchen
atelier-bauplanung.ch
277 FloraparkLenzburg FloraparkLenzburg Hunziker Baumanagement AG
5405
Baden-Dättwil
... Startseite Kontakt Hunziker Gruppe Täfernstrasse CH- Baden-Dättwil www.hunziker
florapark-lenzburg.ch
278 Home «BrauchtumSchweiz.ch» Dornbusch Medien AG Schweiz
5405
Baden-Dättwil
Die Schweiz ist ein Schmelztiegel verschiedenster Einflüsse und Kulturen. Darüber hinaus hat sie eine traditionsreiche
brauchtumschweiz.ch Schweiz Kultur Brauchtum Sagen
279 Sanitär Markt kaufen
5405
Daettwil
sanitaermarkt.ch ist Ihr Onlineshop für Badezimmer Leuchten und Wohnen für Ihre besten Ideen
sanitaer-markt.ch Kaufen Sanitär Waschtisch Kwc
280 Systema Datentechnik | HOME Systema Datentechnik Schweiz AG Systema
5405
Baden-Dättwil
Systema Datentechnik ist ein IT Systemhaus mit Niederlassungen in Deutschland und der Schweiz. Unternehmensschwerpunkte sind
systema-online.ch Systema Datentechnik Systemhaus Potsdam Hamburg
281 Praxis Farfallina null
5405
Baden-Dättwil
null ... . Auf zum Ziel! Praxis Farfallina Chloé Demenga Dättwilerstrasse d Baden-Dättwil infopraxisfarfallina
praxisfarfallina.ch Null
282 Schweizerischer Fachverband für Wärmekraftkopplung Waermekraftkopplu
5400
Baden
Der Schweizerische Fachverband für Wärmekraftkopplung vereinigt rund 100 Mitglieder: Hersteller und Lieferanten von WKKAnlagen
waermekraftkopplung.ch Waermekraftkopplung Kraftwärmekopplung Blockheizkraftwerk WKK KWK BHKW
283 Willkommen bei Handeys Türkeireisen Handeys Reisen GmbH türkei
5400
Baden
Türkei Lastminute aus Istanbul Izmir Bodrum Marmaris Antalya Kemer Belek Side Alanya Badeferien ... GmbH Bahnhofplatz Baden + + infohandeys Newsletter
tuerkeiangebote.ch Türkei Istanbul Izmir Bodrum
284 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
spielfilme.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
285 Weingut zur Linde
5400
Baden
Edle Weine unter der Linde ... Jaussi · Dorfstrasse · CH- Linn ·
sankt-nikolaus.ch
286 Arcoplan varinet GmbH Region
5400
Baden
Wir sind ein Aargauer Planungsbüro und beraten Gemeinden kantonale Fachstellen Architekten Bauherrschaften ... .. ARCOPLAN Lüscher Pfister Keller Zantop Limmatauweg CH- Ennetbaden Telefon
arcoplan.ch Region Baden Raumplanung Baden Raumentwicklung Baden
287 Fotograf Fotoshooting Fotograf
5400
Baden
Fotograf mit Fotostudio für Fotoshootings in Baden (Schweiz). Schwerpunkte: People und Portraitfotografie Bewerbungsfotos
andreurech.ch Fotograf Fotostudio Fotoshooting Portraitfotografie
288 Frau Meise Kaffee Frau
5400
Baden
Frau Meise Kaffee und Design Kultur vereint Gastronomie Einkaufen und Ausgehen zu einem. ... Meise Frau Meise Kaffee und Design Kultur GmbH Untere Halde Baden
fraumeise.ch Frau Meise Kaffee Café Baden
289 DESIGN+DESIGN DesignundDesign GmbH
5400
Baden
Salon für VintageMöbel
designunddesign.ch
290 Willkommen auf Crea Communication
5400
Baden
Aussagekräftige Botschaften und Texte ? in Wort und Schrift. Verfassen redigieren verlesen ? was
crea-communication.ch
291 Home Gehörlosenseelsorge
5400
Baden

gehoerlosenseelsorgeag.ch
292 Gitarrenoase | Home Gitarre
5400
Baden
Die Gitarrenoase ist spezialisiert auf hochwertige Gitarren Verstärker und Effektgeräte! ... ADRESSE Gitarrenoase Theodor Hesse Bäderstrasse Baden Schweiz Zur Karte ÖFFNUNGSZEITEN Mo
gitarrenoase.ch Gitarre Verstärker Amp Effektgerät
293 Home | Glauser AG Glauser AG
5400
Baden
... Aarau Reinach Glauser AG Haselstrasse Baden baden
glauser-orthopaedie.ch
294 Fachschule für Graphologie varinet GmbH assessment
5400
Baden
Graphologische Gutachten und Beratungen; Esther Hasler; Dipl. Graphologin EGS/VDG. Graphologische Gutachten sind CharakterProfile. Stärken und ... Graphologie Stampfenbachstrasse CH- Zürich Telefon + E-mail Me! password
grafo.ch Assessment Bewerbungen Charaktergutachten Graphologie Grafologie
295 Ideebiene idee
5400
baden

ideebiene.ch
296 Eventplaner.ch | Home
5400
Baden

event-planer.ch
297 Title varinet GmbH
5400
Baden

kontiki-garage.ch
298 Home | nachsitzen.ch Nachsitzen24 GmbH Nachhilfe
5400
Baden
Du bist auf der Suche nach Nachhilfe? Hier findest du private Nachhilfelehrer aus deiner Region.
nachsitzen.ch Nachhilfe Nachhilfeportal Nachhilfelehrer Nachhilfelehrerin
299 Title varinet GmbH
5400
Baden

nordik-reisen.ch
300 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
neavita.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
301 Gut zu wissen. Gut
5400
Baden
zB. Zentrum Bildung Wirtschaftsschule KV Baden Weiterbildung Erwachsenenbildung Grundbildung
zentrumbildung.ch Gut Zu Wissen. Gut Zu Wissen.
302 | Tatsachen • Baden
5400
Baden
... Kurt Züllig. Stanzerei Merker-Areal Bruggerstrasse Baden
tatsachen-baden.ch
303 TECH OP AG TECH OP AG
5400
Baden

techop.ch
304 Chiropraktik in Baden Chiropraktik
5400
Baden
Reich bebilderte ausführliche Präsentation über die Chiropraktik sowie Chiropraktik für Pferde.
chiropraktik-baden.ch Chiropraktik Chiropraktor Chiropraktor Baden Chiropraktik
305 Chaeferstube varinet GmbH
5400
Baden

chaeferstube.ch
306 Gutes Essen tolle Restaurant
5400
Baden
lt;h2gt;Gut bürgerliche Küche herzliche Gastgeber und eine tolles Panorama das erwartet Sie im ... Belvédère Belvedere Baden T F ÖFFNUNGSZEITEN Mittwoch ? Samstag .
belvedere-baden.ch Restaurant Belvédère Baden
307 Biergarten baden Baden Event AG Biergarten
5400
Baden

biergartenbaden.ch Biergarten Baden Oase MüllerBräu
308 Black Ball Home
5400
Baden

black-ball.ch
309 Medichina Schweiz: TCM Akupunktur
5400
Baden
TCM Traditionelle Chinesische Medizin Akupunktur Tuina Massage kräuter Schröpfen
medichina-schweiz.ch Akupunktur Chinesische Medizin TCM Traditionelle Chinesische Medizin
310 News Fotograf
5400
Baden
Patrik Tanner Photographie
patriktanner.ch Fotograf Photographer Fotografie Photographie
311 STERK CINE AG | STERK CINE AG STERK
5400
Baden
Die STERK CINE AG mit ihren über 100 Mitarbeiterinnen und Mitarbeitern hat sich aber nicht
sterk.ch STERK CINE AG Peter Sterk Sabine
312 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
audiovision.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
313 Schweizerischer Fachverband für Wärmekraftkopplung Waermekraftkopplu
5400
Baden
Der Schweizerische Fachverband für Wärmekraftkopplung vereinigt rund 100 Mitglieder: Hersteller und Lieferanten von WKKAnlagen
bhkw.ch Waermekraftkopplung Kraftwärmekopplung Blockheizkraftwerk WKK KWK BHKW
314 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
bausektor.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
315 Webdesign Internetagentur BlueMouse GmbH Webagentur
5400
Baden
Sie benötigen eine professionelle Website? BlueMouse ist die Webagentur/Internetagentur in Baden. ... . Ganz einfach. Adressen BlueMouse GmbH Rütistrasse CH- Baden BlueMouse GmbH Bordeaux- CH
bluemouse.ch Webagentur Internetagentur Webdesign Baden
316 Sprachkurse Baden Firmensprachkurse Sprachkurse
5400
Baden
Sprachkurse Baden Firmensprachkurse Business Sprachkurse Zürich TLC The Language Company ... Schweizerischer Verband für Weiterbildung TLC ? The Language Company Bahnhofstrasse CH- Baden Tel
tlcsprachschule.ch Sprachkurse Baden Firmensprachkurse Business Sprachkurse Zürich
317 Moser's Backparadies und Kafi Moser’s Backparadies AG Moser's
5400
Baden
Moser's Backparadies und Kafi Baden Zürich Kaffee Sandwich Brot
gsmgroup.ch Moser's Backparadies Und Kafi Baden Zürich
318 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
morph.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
319 Das Musikfachgeschäft in Baden Musikinstrumente
5400
Baden AG
Musikinstrumente kaufen mieten reparieren stimmen und liefern lassen. Umfassendes Sortiment und kompetente
bmusik.ch Musikinstrumente Baden Aargau Miete
320 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
mediacreation.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
321 Ristorante Pizzeria il Brunello Spezialitäten
5400
Baden
Ristorante Pizzeria il Brunello Baden Aargau. Italienische Spezialitäten sowie internationale Delikatessen können Sie
ristorante-il-brunello.ch Spezialitäten Aus Italien Italienische Küche Aus Baden
322 Sagittaria | Naturschutz in
5400
Baden

sagittaria.ch
323 Willkommen im weissen keller! weisser
5400
Baden
Willkommen im Weissen Keller!
weisserkeller.ch Weisser Keller Baden Reformiert Jugendtreff
324 Verenahof AG: Das Bäderquartier Verenahof AG hotel
5400
Baden
Gemeinsame Planungsabsicht der Verenahof AG und der Stadt Baden ist eine Entwicklung
verenahof.ch Hotel Verenahof Switzerland Schweiz Baden Thermal Therme Fitness
325 Webdesign Schweiz: Top Webdesign Webdesign
5400
Baden
VARINET GmbH new media facotry
varinet.ch Webdesign Webprogrammierung Emarketing Hosting
326 Neavita | Praxis für Ernährungsberatun
5400
Baden
Radikale Diäten fördern nur den JojoEffekt. Oft wird zum Essen gegriffen um ein Ungleichgewicht
e-shops.ch Ernährungsberatung ErnährungsPsychologische Beratung Ernährung Essstörungen
327 Schweizerischer Fachverband für Wärmekraftkopplung Waermekraftkopplu
5400
Baden
Der Schweizerische Fachverband für Wärmekraftkopplung vereinigt rund 100 Mitglieder: Hersteller und Lieferanten von WKKAnlagen
cogeneration.ch Waermekraftkopplung Kraftwärmekopplung Blockheizkraftwerk WKK KWK BHKW
328 Home | marketingwerk Marketingwerk AG
5400
Baden
... . Sie erreichen uns wie folgt Marketingwerk AG Kurplatz Baden Telefon Mobile
marketingwerk.ch
329 English Centre Sprachzentrum
5400
Baden

english-centre.ch
330 Home Lieferadresse
5400
Baden
Sparen Sie Versandkosten! Mit einer eigenen Lieferadresse in Deutschland. Schluss mit den hohen Versandkosten bei InternetBestellungen
europaketshop.ch Lieferadresse Deutschland Versandkosten Sparen
331 GALERIE ANIXIS
5400
Baden

anixis.ch
333 Home BACHER ENERGIE AG
5400
Baden
This is the home page of BACHER ENERGIE AG BACHER ENERGY LTD. CEO is
bacherenergie.ch
334 Startseite: bachmannundpartner.ch Werbeagentur
5400
Baden
Wir sind die klassische FullService Werbeagentur Kommunikationsagentur und Webagentur im Kanton Aargau. In Baden
bundp.ch Werbeagentur Kommunikation Kommunikationsagentur PR
335 Elektro Support Team GmbH Elektro Support Team GmbH Elektro
5400
Baden
Ich suche eine:   Stelle Ich suche einen:   Mitarbeiter Ich suche ein:
elektro-team.ch Elektro Team Elektro Support Elektro Support Subunternehmen Lehrstellen
336 Hertalan in der Schweiz
5400
Baden
... Hertalan in der Schweiz Schartenfelsstr. Baden T + F + Home
epdm.ch
337 Home
5400
Baden

flex-baden.ch
338 Www.fitnesscenterbaden.ch:80 | Fitnesscenter Baden www.fitnesscenter
5400
Baden
www.fitnesscenterbaden.ch:80 Fitnesscenter Baden Sportmedizinisches Trainingszentrum Ihr Weg zur Ihrer Fitness und Gesundheit
fitnesscenterbaden.ch Www.fitnesscenterbaden.ch:80 Verwöhnung Flosaldrom Medizinische Massagen
339 Freuler Metallbau AG: Anspruchsvolle Freuler Metallbau AG Freuler
5400
Baden
FREULER METALLBAU AG: Ihr Partner f黵 anspruchsvolle Metallbau und Schlosserarbeiten aller Art Einzelanfertigungen ... zu unserer zufriedenen Kundschaft zählen zu dürfen. Copyright FREULER METALLBAU AG CH- Baden
freuler-metallbau.ch Freuler Metallbau Freuler Metallbau AG
340 Ingenodata Ingenodata AG
5400
Baden

ingenodata.ch
341 Startseite | Tanzkurs.ch
5400
Baden

tanzkurs.ch
342 JustNet.ch JustNet GmbH JustNet GmbH
5400
Baden
JustNet GmbH Webhosting Serverhousing Domain Registration
justnet.ch
343 Startseite LB Logistikbetriebe LB Logistikbetriebe Holding AG
5400
Baden
Produkte und Dienstleistungen im Bereich Stahl + Metalle Materialprüfung Industriebedarf Bürobedarf ... Anarbeit Lieferservice E-Shop Stahl LB MetallService AG Fabrikstrasse CH- Baden Telefon +
lb-log.ch
344 Lasertherapie
5400
Baden
... für Hautkrankheiten Oberstadtstrasse Baden Tel + + Willkommen bei Dermabaden
laserbaden.ch
345 STERK CINE AG | STERK CINE AG STERK
5400
Baden
Die STERK CINE AG mit ihren über 100 Mitarbeiterinnen und Mitarbeitern hat sich aber nicht
kino-baden.ch STERK CINE AG Peter Sterk Sabine
346 Ken Architekten Ken
5400
Baden
Ken Architekten entwickeln verblüffende Lösungen von höchster architektonischer Qualität die wirtschaftlich und nachhaltig sind.
ken-architekten.ch Ken Ken Architekten Jürg Kaiser
347 Kathrindex
5400
Baden

kathrin.ch
348 Gabriele Kulstrunk
5400
Baden

kulstrunk.ch
349 Orea Kosmetikstudio Orea
5400
Baden
... Cordulaplatz Baden info?kosmetikorea-baden zum Kontaktformular Herzlich willkommen beim
kosmetikorea-baden.ch
350 Frauenarztpraxis J.F.P. Schüttpelz
5400
Baden
... AG Institut für Gynäkologie und ästhetische Medizin Badstrasse CH- Baden FRAUENARZTPRAXIS
kosmetikinstitut-baden.ch
351 La Cucina Catering anlass
5400
Baden

la-cucina-catering.ch Anlass Kochen Geniessen Baden
352 HotelRistorante La Cappella Hotel
5400
Baden
Seien Sie Gast in unserem Hotel und Restaurant geniessen Sie unsere professionelle diskrete ... CH- Baden + Foto+Design BlueWaterCom Webdesign Pixelhouse
lacappella.ch Hotel Restaurant Baden Hotelzimmer
353 Lourdespilgerverein Baden und Umgebung
5400
Baden
... Lourdespilgerverein Baden und Umgebung Kirchplatz Baden schicken an .. ... den gesamten Vorstand
lpv-baden.ch
354 Modern office : büroraumkonzepte
5400
baden

modern-office.ch
355 Modelin Modelin
5400
Baden
... Links Lageplan Modelin SA Cordulaplatz Baden Oeffnungszeiten
modelin.ch Modelin Obere Gasse Baden Dessous Unterwäsche Top Tagwäsche
356 Bauunternehmen bauunternehmung
5400
Baden
bauunternehmen bauunternehmung baugeschäfte aargau baden brugg windisch wettingen ... Geschäftspartner und ? Weiterlesen... Adresse/ Mäder AG Bauunternehmen Dynamostrasse Baden Tel
maederbau.ch
357 Meng und Partner Gruppe Meng und Partner Revisions AG Wirtschaftsprüfun
5400
Baden

meng-partner.ch Wirtschaftsprüfung Steuerberatung Rechtsberatung Unternehmensberatung Treuhand T
358 Markenartikelversandhaus Memo Trade Memo Trade AG Mammut
5400
Baden
Memo Trade AG: Markenartikelversandhaus bekannt für hochwertige Marken für Bekleidung Bettwäsche Bettwaren
memotrade.ch Mammut Outdoor Isa Bodywear Rohner Socken
359 Unternehmen MeisterSchifferle GmbH Meister & Schifferle GmbH
5400
Baden
... Schifferle GmbH Zürcherstrasse Baden infomeisterschifferle
meisterschifferle.ch
360 Home | Maybaum Film Maybaum GmbH Video
5400
Baden
Maybaum Film ... Merker-Areal Baden T + infomaybaum Adresse Bern Optingenstrasse Bern
maybaum.ch Video Schnitt Film Agentur
361 Herzlich willkommen Ludothek
5400
Baden
Ludothek Baden. Gesellschaftsspielen für jede Alterskategorie und Erwachsene. Spielsachen für Kleinkinder verschiedenste Fahrzeuge
ludothek-baden.ch Ludothek Baden Spiele Spielsachen Gesellschaftsspiele
362 Malatelier Baden
5400
Baden
... Neuenhoferstrasse Baden
malatelierbaden.ch
363 MATRIX2POINT mit KatharinaAniya Mies Matrix
5400
Baden
Coachings und Seminare durch die leicht zu lernende 2PunktMethode kann man körperliche emotionale
matrix-creative.ch Matrix MATRIX2POINT Matrix Transformation Richard Bartlett Frank Kinslow
364 Viva Baden
5400
Baden

mamba-bar.ch
365 LWB:  PROGRAMM Party Pur Event GmbH
5400
Baden
... LÖSCHWASSERBECKEN STADTTURMSTRASSE BADEN LWB NEWSLETTER BESTELLEN PROGRAMM BAR CLUB
lwb-baden.ch
366 Willkommen | Merkitreuhand AG Merki Treuhand AG Treuhand
5400
Baden
Merki Treuhand Wirtschafts und Steuerberatungen Theaterplatz 8 5400 Baden ... »¿Steuerberatungen Theaterplatz Baden T F infomerkitreuhand
merkitreuhand.ch Treuhand Steuern Beratung Merki
367 Mechthild Schreck Dolmetscherin: dolmetschen
5400
Baden
Sie organisieren eine Sitzung eine Konferenz in mehreren Sprachen und suchen jemand der ... mich freuen! Adresse Mechthild Schreck Diplom-Dolmetscherin Deutsch ↔ Französisch Burghaldenstr. CH-
mechthild-schreck.ch Dolmetschen übersetzen Deutsch Französisch Spanisch Englisch übersetzer übersetz
368 Meier Daniel Treuhand AG Meier Daniel Treuhand AG Treuhand
5400
Baden
Meier Daniel Treuhand AG | Unternehmensberatung Baden Firmengründung Baden Steuererklärung ausfüllen lassen ... Daniel Treuhand AG Mellingerstrasse Baden . infomd
md-treuhand.ch Treuhand Baden
369 Marius Brühlmeier | Marius
5400
Baden

marius-bruehlmeier.ch
370 Home Grieder Sport Baden AG
5400
Baden

markasport.ch
371 Home | the musical
5400
Baden

musicalbox.ch
372 New Media Context ? lektorat
5400
Baden
New Media Context ? Textoptimierung Lektorat Dissertation Masterarbeit Diplomarbeit
nmc.ch Lektorat Lektorieren Redaktion Korrektorat
373 Noëmi Sohn Sängerin noemi
5400
Baden
Noëmi Sohn Sopran. Als freischaffende Konzertsängerin interpretiert sie Werke von Barock über Romantik bis
noemisohn.ch Noemi Sohn Noemisohn Noemi Noëmi
374 OfficeWest AG OfficeWest AG
5400
Baden
... . OfficeWest AG Weite Gasse CH- Baden Telefon Tele officeofficewest
officewest.ch
375 Neuhaus Wettingen Immotip AG
5400
Baden

neuhaus-wettingen.ch
376 Oliverio :Oliverio
5400
Baden
Hier erfährst Du alles über Oliverio Kollektionen Events und latest News
oliverio.ch
377 Home ? MWV Bauingenieure MWV Bauingenieure AG
5400
Baden
... Birmensdorf Brückenverbreiterung Wehntalerstrasse Regensdorf MWV Bauingenieure AG Bruggerstrasse
mwv.ch
378 ABB Schweiz AG ABB Schweiz AG
5400
Baden
ABB (www.abb.com) is a leader in power and automation technologies that enable utility and industry ... Brown Boveri Platz CH- Baden + + gebaeudeautomation
normelec.ch
379 Callanetics intelligentes bewegen
5400
Baden

pilatesbaden.ch
380 Panorama Baden Fritz Wanner & Co. Restaurant
5400
Baden
Panorama Baden Roof top after work lounge ... Baden Wir sind in der Herbstpause! Die Panorama Sommersaison endete Ende
panoramabaden.ch Restaurant Bar Terrasse Drinks
381 Parvitas Ernährungsberatung Marion
5400
Baden
Eine sinnvoll zusammengesetzte Ernährung ist eine wichtige Voraussetzung um körperlich und geistig gesund und
parvitas.ch Marion Zanella Parvita Parvitas Ernährung
382 Wer wir sind
5400
Baden
... Geschäftsstelle Pro Juventute Verein Aargau Pro Juventute Kanton Aargau Haselstrasse Baden
projuventute-ag.ch
383 Schreinerei für Innenausbau Habilis GmbH Schreinerei
5400
Baden
Schreinerei Habilis 5400 Baden Schreinerei für Innenausbau Küchen Haustüren Reparaturen ... Schreinerei Brisgistrasse Baden Tel infoprohabilis Herzlich
prohabilis.ch Schreinerei Habilis Baden Innenausbau Einzelanfertigung
384 Die Orthopädische Praxis am
5400
Baden
... und Akupunktur Stadtturmstrasse Baden T F www.praxis-am-stadtturm
praxisamstadtturm.ch
385 Manuel Stutz Klassische
5400
Baden
... Baden Telefon Handy
praxis-stutz.ch
386 Penatec GmbH Ihre Penatec GmbH penatec
5400
Baden AG
Penatec GmbH Ihre Sicherheit ist unser Ziel. Wir bieten Ihnen komplette Sicherheitslösungen zur Videoüberwachung ... -Partner der Firma eyes. mehr Informationen Penatec GmbH ? Ländliweg ? CH- Baden AG ? T
penatec.ch Penatec Video Kamera überwachung
387 The Plagiators ? Besser martin
5400
Baden
Sie suchen eine Coverband die Songs nicht einfach so nachspielt wie sie im
plagiators.ch Martin Perini Franziska Perini Martin Sitter
388 Die Pferdemassage
5400
Baden

pferdemassage.ch
389 ABB PowerPlanner Baue
5400
Baden
Baue Kraftwerke und versorge eine Region mit einem smarten Strommix
powerplanner.ch
390 Ihre Notfall und Hausarztpraxis Permanence 21 AG Stichwort
5400
Baden
Ein Beschrieb der hier fehlt ... Notfall- und Hausarztpraxis Bruggerstrasse CH- Baden Telefon notfall(at
permanence21.ch Stichwort Die Hier Fehlen
391 Pontoniere Baden Willkommen Pontonier
5400
Baden
Wir rudern und stacheln auf der Limmat nicht weit vom Stadtzentrum Baden entfernt
pontonierebaden.ch Pontonier Baden Verein Rudern
392 Peter Fasnacht Aktuell Handwerk
5400
Baden
... PETER FASNACHT Peter Fasnacht Schuhhalt Untere Halde Baden Aktuell
peterfasnacht.ch Handwerk Taschen Aus Leder Unikate
393 ROTOSPHERE · Black Music
5400
Baden
... best! by rotosphere Baden inforotosphere
rotosphere.ch
394 Sebastiano Bucca Sebastiano Bucca
5400
Baden
... CH- Baden
sebastianobucca.ch
396 Herzlich willkommen | Schmerzpraxis
5400
Baden
... . Roland Glinz Rütistrasse CH- Baden Tageschirurgie Baden Telefon Tele
schmerzpraxis-baden.ch
397 Salsa Tanzschule Salsafiguren BTC - Badener Tanzcentrum AG Tanzen
5400
Baden
Woher stammt überhaupt Salsa? Wie tanzt man Salsafiguren? Besuchen Sie einen unseren Salsakurse. ... im Badener Tanzcentrum Badener Tanzcentrum AG Martinsbergstrasse Baden Copyright by Badener Tanz
salsa-tanzschule.ch Tanzen Baden Salsa Cuba
398 Home salzpfaeffers Webseite!
5400
Baden

salz-pfaeffer.ch
399 AGPKJP Aargauische Gesellschaft aargauische
5400
Baden
Die offizielle Seite der Argauischen Gesellschaft für Psychiatrie Kinder und Jugendpsychiatrie (AGPKJP) ... Baden #Top Copyright AGPKJP - Alle Rechte vorbehalten
psychiatrie-aargau.ch Aargauische Gesellschaft Für Psychiatrie ärtze Agp
400 Roger Wehrli Roger Reportage
5400
Baden
Roger Wehrli Fotografie
rogerwehrli-fotografie.ch Reportage Reportagen Portrait Portraits
StadtBranche.ch Orts-Portrait von Rütihof in Aargau Schweiz. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Rütihof erhält 3 StadtBranche.ch Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt

Rütihof
Aargau ▪ 5406

Rütihof ist ein Dorf im Kanton Aargau in der Schweiz. Es liegt im Reusstal, zählt rund 2400 Einwohner und bildet eine Exklave der Stadt Baden, zu der es seit 1962 gehört. Im Süden grenzt Rütihof an Mellingen, im Osten an Fislisbach, im Norden und Westen an Birmenstorf. Unmittelbar an der westlichen Grenze liegen die zu Birmenstorf gehörenden Weiler Müslen und Muntwil. Das Stadtzentrum Badens liegt knapp fünf Kilometer nordöstlich.

OrtPLZ
Baden5400
Baden 15400
Baden B&V GK5405
Baden B&V GK 25405
Baden IM5400
Baden Täfern Gewerbe5405
Dättwil AG5405
Ennetbaden5408