optional Stadt:
Schweiz › Ort ›

Les › Wallis › Österreich › 1992 Erfahrungen

Branchenbuch Les

1992 Wallis

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:




1 günstige Hochzeitsfotografie & coole Fotograf at
5020
Salzburg
Die „Fotomacherei“ Mit einer „Macherei“ verbindet man etwas aus der Vergangenheit, etwas Altes, so wie zB. eine Greißlerei. Die Grundsätze von damals...
fotomacherei.at Vintage Fotobox Wohnwagen Lieben Hochzeiten Festgehalten Besuchen Webmaster Hochzeitseinladungende Unser Webseite Firmenevents Hochzeitsfotografie Fotografie Fotomachereiat Emma
2 find---me! Tiefschneeband Wintersport at
5020
Salzburg
Die innovativen Tiefschneebänder für Tourenskifahrer, Freerider, Tiefschneefahrer und Variantenfahrer: find---me! ist nicht nur Fangschnur und Fangriemen gegen das Verlieren von...
find---me.com/ Shop Lawine Tiefschneeband Presse Tiefschnee Funktion News Sicherheit Ski Find—me Blog Skischulen Lawinenband Lawinen Tiefschneefahrer Menschen Videos Ernst
3 Body House Sonia Caparrelli Massage Wellness ch
9214
Kradolf
Angebote im Body House Kradolf sind: Klassische Ganzkörpermassagen und Teilmassagen/ Ägyptos Ganzkörper Vital Wickel Detox ( Entgiftung und Straffung des...
epilsoft.ch/aegyptos-ganzkoerper-wickel-und-body-house/index.html Haarentfernung Epilsoft Pads Massagen Valuron Körperpflegestudio Body House Creme Kit Pflegeprodukte Damenbart Hair Men Natürlich Kosmetik Wachs
4 Bedruckte Papiertragetaschen mit Logo Werbeartikel at
4020
Linz
Werbetaschen aus Papier mit Firmenlogo gesucht? Das Unternehmen GWV GmbH aus Oberösterreich produziert bedruckte Papiertragetaschen. Das Sortiment enthält dabei Papiertragetaschen...
papiertaschen.at/
5 Feuershow & Lichtshow Feuershows - ch

Basel
Art of flames bietet Feuershows und Lichtshows mit einer einmaligen Kombination aus Akrobatik, Tanz und Bewegung, synchronisiert zur Musik. Buchen...
art-of-flames.ch Feuershow Basel Schweiz Deutschland Lernen Share Frankreich Mich Lichtshow Feuershows Bewegung Musik Tanz Akrobatik Besonderen Eng
6 pferdegestütztes Training Training at
2821
Lanzenkirchen
Im pferdegestützten Coaching erleben Sie emotionale Höhepunkte, dadurch bleiben die erarbeiteten Inhalte länger in Erinnerung. Durch die Arbeit mit Pferden werden...
horseforcompany.at/ Coaching Training Methoden Pferdegestütztes Workshops Konfliktmanagement Pferde Pferden Horse Wirkung Stressabbau Themen Selbstmanagement Ergeben Company Unbestechlichen Präsenz Ungeschminkt
7 günstige Hochzeitsfotografie & coole Fotograf at
5020
Salzburg
UNVERGESSLICHE MOMENTE – FESTGEHALTEN VON UNS „Wir lieben Fotos! Und wir lieben Hochzeiten!“ – Wir begleiten euch, um den schönsten Tag...
fotomacherei.at Vintage Fotobox Wohnwagen Besuchen Webmaster Hochzeitsfotografie Lieben Hochzeiten Mycardshopde Hochzeitseinladungende Firmenevents Fotomachereiat Webseite Unser Fotografie Firmenevent
8 Hotel Stadt Wien Zell Hotel at
5700
Zell am See
Das Familienhotel und Ferienhotel Stadt Wien begeistert zu allen Jahreszeiten: Das Hotel in Zell am See in der Region Pinzgau...
hotel-stadt-wien.com/
9 Vorwerk Staubsaugerbeutel Vorwerk Staubbeutel Service und at
3040
Neulengbach
Vorwerk Staubsaugerbeutel Vorwerk Staubbeutel Vorwerk Filtertüten Vorwerk Zubehör Vorwerk Ersatzteile für Vorwerk Tiger 250 Vorwerk Tiger 251 Vorwerk Tiger 252...
staubsauger-service.jimdo.com Z Y
10 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
3040
Neulengbach
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
kirby-zubehoer-kirby.jimdo.com
11 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
3040
Neulengbach
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
kirby-zubehoer-kirby.jimdo.com
12 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
3040
Neulengbach
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
kirby-zubehoer-kirby.jimdo.com
13 Cannabis King CBD Online ch
1801
Le Mont Pèlerin
Cannabis King – Der online shop für CBD Blüten und Zubehöre. Unser Team ist ständig auf der Suche die besten Produkte...
cannabisking.ch
14 Vortech Force Staubsaugerbeutel Vortech Service und at
3040
Neulengbach
Vortech Force Staubsaugerbeutel Vortech Force Staubbeutel Vortech Force Zubehör Vortech Force Staubsauger Zubehör Vortech Force Staubfilter für Vortech Force XR-3000...
vortech-force-staubbeutel.jimdo.com Z Y
15 Sakura Zubehör Sakura Staubsauger Service und at
3040
Neulengbach
Sakura Zubehör Sakura Staubsauger Zubehör Sakura Staubsauger Service Sakura Ersatzteile Sakura Service Sakura Staubsauger Ersatzteile Firma Haushaltsgeräte Rozenich Erreichbar Mo...
sakura-staubsauger-service.jimdo.com Z Y
16 Ipoh Cuisilux Zubehör Ipoh Service und at
3040
Neulengbach
Ipoh Cuisilux Zubehör Ipoh Cuisilux Ersatzteile Ipoh Cuisilux Service Ipoh Cuisilux Kundendienst Ipoh Cuisilux Kundenservice Ipoh Cuisilux Reparatur Firma Haushaltsgeräte...
ipoh-cuisilux-zubehoer-ipoh.jimdo.com Z Y
17 Ipoh Bio Universalgerät Zubehör Service und at
3040
Neulengbach
Ipoh Bio Universalgerät Zubehör Ipoh Bio Universalgerät Ersatzteile Ipoh Bio Universalgerät Service Ipoh Bio Universalgerät Kundendienst Ipoh Bio Universalgerät Reparatur...
ipoh-kuechenmaschine-ipoh-cuis.jimdo.com Z Y
18 Ipoh Küchenmaschine Zubehör Ipoh Service und at
3040
Neulengbach
Ipoh Küchenmaschine Zubehör Ipoh Küchenmaschine Ersatzteile Ipoh Küchenmaschine Service Ipoh Küchenmaschine Kundendienst Ipoh Küchenmaschine Kundenservice Ipoh Küchenmaschine Reparatur Firma Haushaltsgeräte...
ipoh-kuechenmaschine-zubehoer.jimdo.com Z Y
19 Ipoh Küchenmaschine Zubehör Ipoh at
3040
Neulengbach
Ipoh Küchenmaschine Zubehör Ipoh Küchenmaschine Ersatzteile Ipoh Küchenmaschine Service Ipoh Küchenmaschine Kundendienst Ipoh Küchenmaschine Kundenservice Ipoh Küchenmaschine Reparatur Firma Haushaltsgeräte Rozenich...
20 Lura Wasserstaubsauger Zubehör Lura Service und at
3040
Neulengbach
Lura Wasserstaubsauger Zubehör Lura Staubsauger Zubehör Lura Zubehör Lura Wasserstaubsauger Ersatzteile Lura Staubsauger Ersatzteile Lura Ersatzteile Lura Kundendienst Lura Service...
lura-wasserstaubsauger-lura.jimdo.com Z Y
21 Thermostar Dampfreiniger Zubehör Thermostar Service und at
3040
Neulengbach
Thermostar Dampfreiniger Zubehör Thermostar Zubehör Thermostar Avantgarde Dampfreiniger Thermostar Professional Zubehör Thermostar Avantgarde Zubehör Thermostar Dampfreiniger Kundendienst Thermostar Dampfreiniger Ersatzteile...
thermostar-dampfreiniger.jimdo.com Z Y
22 Linetti - Spezialist für Schlafsysteme at
9500
Villach
Verantwortungsvolle Konsumenten, die einen online Möbel-Shop suchen, werden auf Linetti Living fündig. Neben Bettenkollektionen aus verschiedensten Vollhölzern, komfortablen Schlafunterlagen in...
linetti.com/
23 SAP FICO Freelancer SAP Consulting ch
8484
Weisslingen
Als erfahrener SAP Freelancer im Bereich Finanzen & Controlling (FI CO PS IM) stehe ich Ihnen für Ihr SAP-Projekt zur...
sap-fico-freelancer.ch Fico Sap Freelancer Consultant Shana Einführung Berater Controlling Schweiz Schulungen Konzeption Co Systemhaus Design Kostenträgerrechnung Customizing Profit Center Go Live Rechnung
24 Venatores Personalberatung at
5020
Salzburg
venatoresmp.com Z Y
25 Busundco. Unternehmen at
4300
St.valentin
1111144444888...
cyrus&co.com
26 Busundco. Unternehmen at
4300
St.valentin
1111144444888...
cyrus&co.com
27 Busundco. Unternehmen at
4300
St.valentin
1111144444888...
cyrus&co.com
28 Busundco. Unternehmen at
4300
St.valentin
1111144444888...
cyrus&co.com
29 Embabox Verpackung at
2473
Potzneusiedl
Stilvolle Verpackungen aus natürlichem Holz. Direkt vom Produzenten. Individuell und punktgenau personalisiert. Seit 1918. Damit ist alles gesagt. Gefragt ist...
embabox.com Mein Anmelden Warenkorb Weinboxen Geschenkverpackungen Holzwolle Genussboxen Outlet Konto Kasse Embabox Holzverpackungen Muster Widerrufsformular Weinkisten Ab Ihrem Kategorien Tortenkisten
30 Nagelstudio Kosmetik Beauty at
5026
Salzburg
Nagelstudio, Nails, Nagel, Wimpern, Wimpernverlängerung, Permanent Make Up, Tattoos, Salzburg, Günstig, professionell, Pflegeprodukte, Nuskin,...
nagel-und-beauty.at Permanent Nageldesign Nagel Kurse Schönheitstattoos Ausbildung Schönheit Wege Ich | Seitehin Homepagetattoos Stimme
31 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
3656
Aeschlen
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
basads.ch
32 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
3656
Aeschlen
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
basads.ch
33 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
3656
Aeschlen
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
basads.ch
34 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
3656
Aeschlen
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
basads.ch
35 SV-Weber Betriebswirt-Rechtsökonom-Sachverständiger-Honorarberater Sachverständige Gutachter at
59929
Brilon
SV-Weber Betriebswirt-Rechtsökonom-Sachverständiger-Honorarberater für Finanzierung, Kredit, Darlehen, Leasing und Investition, Kreditsachverständiger/Kreditgutachter für das Kreditwesen, Kapitalwesen und Bankwesen, Rechtsökonom für das Vertragswesen,...
weber-gutachter.com
36 Reiteralm & Fageralm Bergbahnen Bergbahnen at
8973
Schladming
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
reiteralm.at/
37 Reiteralm & Fageralm Bergbahnen Bergbahnen at
8973
Schladming
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
reiteralm.at/
38 Reiteralm & Fageralm Bergbahnen Bergbahnen at
8973
Schladming
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
reiteralm.at/
39 Darlehen ab 10.000 € Finanzierung Online at
7311
Burgenland
Guten tag Wir sind eine institution, die von micro finance bieten wir lösungen für einfache finanzierung in form von hypotheken. Wir bieten...
stadtbranche.at Ratgeber Mopswelpen Wien Klöster Magazin Boote Unternehmen Erfahrung Stadtbrancheat Media Partner Tschagguns Klösterreich Band Österreich Haltung * Championzucht Social Sportbootverleihauch
40 Küken Junghennen und Stalltechnik Landwirtschaft at
2640
Gloggnitz
Spitzenqualität, Kundenservice und Partnerschaft – dafür steht der Name Schropper seit über 85 Jahren. Das Know-how beruht auf der langjährigen...
schropper.at/
41 Zahnärzte Amodent Zahnarzt at
8010
Graz, 02. Bezirk: Sankt Leonhard Graz
Ihr Zahnarzt in Graz Leonhardstraße 56. Die Praxisgemeinschaft Amodent bietet allgemeine Zahnheilkunde und Kieferorthopädie unter einem Dach. Für eine optimale...
amodent.at Graz Amodent Prophylaxe Assistentin Zähne Team Zahnarzt Tage Termin Zhne Schwellungen Wunde Zahnärztliche Prof Behandlung Zahnärzte Straß Jahren Wattestbchen
42 Bonsai-Studio Emmi Bonsai ch
5314
Kleindöttingen
Ihr Bonsai-Spezialist mit über 15 Jahren Erfahrung Pflege & Gestaltung von Bonsai und Gartenbonsai-Pflanzen Beratung, Formschnitt, Formgebung mit Draht, Neu- und...
bonsai-studio.ch Emmi Bonsai Studio Beratung Projekt Ferienpension Baum Pflege Uns Studioch Kauf Gallery Kontaktaufnahme Unterhaltkleindöttingen
43 Übersetzungsbüro Englisch Russisch und Übersetzungen Übersetzer at
8750
Judenburg-Murtal
Übersetzungen in den Sprachen Englisch, Russisch und natürlich Deutsch in allen Kombinationen. Zusätzlich zu den bekannten Tätigkeitsbereichen eines klassischen Übersetzungsbüros...
enru.at
44 mbs Transporte at
6922
Wolfurt Vorarlberg
Transporte EU weit bis 1, 5 Tonnen , Kleintransporter mit Anhänger bis 3, 5 Tonnen. 7 tage die Woche ...
mueller-boten-service.eu Z Y
45 Auto-Motorrad und Bootsfahrschule Fahrschule ch
6005
Luzern
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
fahrschule-schaer.ch Z Y
46 Auto-Motorrad und Bootsfahrschule Fahrausbildung ch
6005
Luzern
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
fahrschule-schaer.ch
47 Auto-Motorrad und Bootsfahrschule Fahrausbildung ch
6005
Luzern
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
fahrschule-schaer.ch
48 Bouillon Saucen Würzmittel Gesunde Nahrung ch
8304
Wallisellen
Nahrungsmittel ohne tierische Fette. Bouillon: Suppella Bratensauce: Sossella Würzmittel: Salatfein, Kräutergewürzsalz, ...
dreizehnter.ch Suppe Bouillon Allwürzmittel Hühner Klare Feine Suppella Asal Sauce Tellofix Sosse Helle Delikatess Bratensoße Grill Rinds Dreizehnterch
49 Klösterreich - 24 Klöster Kloster at
3491
Straß im Straßertale
Die 24 Klöster und Stifte des Klösterreichs haben viel zu bieten. Eine große Palette von Festen und Veranstaltungen gibt es...
kloesterreich.at/home/ Stift Klösterreich Kloster Videos Pilgern Zeit Musik Kultur Klöster Gesundheit Gärten Einkehr Exerzitien Gast Besinnung Klostergarten
50 Klösterreich - 24 Klöster Kloster at
3491
Straß im Straßertale
Die 24 Klöster und Stifte des Klösterreichs haben viel zu bieten. Eine große Palette von Festen und Veranstaltungen gibt es...
kloesterreich.at/home/
51 MindSpirit Hypnosetherapie & Mental Coaching Hypnose ch
8911
Rifferswil
WIRKSAME VERÄNDERUNG MIT EFFIZIENTEN METHODEN Erfolgreiches und nachhaltiges Coaching oder Therapie muss nicht lange dauern. Mit MindSpirit Hypnosetherapie und Mental Coaching...
mindspirit.ch Hypnosetherapie Coaching Mindspirit Mental Mich Termin Teilen Kosten Hypnorelax Kostenlosen Lange Effizienten Info[at]mindspiritch | Wirksame
52 Flyer verteilen Flyerverteilung Zürich ch
8152
Glattbrugg Zürich
Flyer verteilen in Zürich ab CHF 85.-- Flyer veteilen in Basel ab CHF 100.-- Flyer veteilen in allen Bezirken Kt. Zürich ab...
flyer-verteiler.ch Z Y
53 wohnboutique Haushalts- & ch
4133
Pratteln
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
wohnboutique.ch
54 wohnboutique.ch Haushalts- & ch
4133
Pratteln
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
wohnboutique.ch
55 wohnboutique.ch Haushalts- & ch
4133
Pratteln
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
wohnboutique.ch
56 Trauerbegleitung Beratung ch
8180
Bülach
Die Lebens- und Trauerbegleitung hilft und unterstützt dort, wo es weh getan hat. Verluste sind nicht einfach zu verkraften und...
lebenundtrauern.ch Z Y
57 Agrarimmobilien Immobilien ch
6002
Luzern
Auswanderung effizient angehen, damit die Suche nach einer Wunschliegenschaft erfolgreich verläuft! Zu den alternativen Auswanderungsländern für junge Bauern und Bauernfamilien zählt...
immospecial.com
58 Agrarimmobilien Immobilien ch
6002
Luzern
Auswanderung effizient angehen, damit die Suche nach einer Wunschliegenschaft erfolgreich verläuft! Zu den alternativen Auswanderungsländern für junge Bauern und Bauernfamilien zählt...
immospecial.com
59 Strategisches Marketing Marketing at
8200
Gleisdorf
Wir kümmern uns um die Konzeptionierung und Strategische Planung von Unternehmen und Produkten in den Bereichen Geo-Marketing, für die Regionen...
blue-wavez.com Marketing Agentur Partner Wavez Webdesign Blue Strategische Agency Company Creative Funstuff Projectmanagement Project Kontaktieren Privatsphäre Services Liegt Careers
60 David Umzug Umzug ch
3018
Bern, Switzerland
Wir machen jede Art von Umzügen. Wohnungsumzüge, Hausumzüge, Umzüge innerhalb von Bern oder in jeder Stadt in der Schweiz, internationale...
david-umzug.ch Umzugsfirma David Bern Umzug Umzüge Anfrage Senden Wordpressorg Rss Entries Zimmer Angebot Möbelpacker Umzugsunternehmen Schweiz Habseligkeiten Umzugsmit
61 Christoph Schlick - Logotherapie Logotherapie at
5020
Salzburg
Christoph Schlick bietet neben Coaching und Training im Bereich Persönlichkeitsentwicklung und Persönlichkeitsbildung auch Seminare und Vorträge zum Thema Sinnsuche, Lebensgestaltung...
christophschlick.com/ Seminare Vorträge Christoph Schlick Information Blog Pressespiegel Meine Partner Leistungen Mein Vision Leben Salzburg Coachings Bietet Beratung
62 SiBO Verpackungen Bernd Hesse Verpackung at
57482
Wenden - Gerlingen
1948 gegründet, zählt SiBO - Verpackungen heute zu den innovativsten Unternehmen in der Verpackungsbranche. Stetige Investitionen in die Produktion, die...
sibo.com
63 SiBO Verpackungen Bernd Hesse Verpackung at
57482
Wenden - Gerlingen
1948 gegründet, zählt SiBO - Verpackungen heute zu den innovativsten Unternehmen in der Verpackungsbranche. Stetige Investitionen in die Produktion, die...
sibo.com
64 ecscad ecscad Elektrotechnik Engineering ch
8185
Winkel
EFFIZIENT und PRÄZISE! Elektrodokumentation mit ecscad Aber nicht nur das! ecscad kann mehr als nur Stromlaufpläne Die Elektro-CAD / CAE-Software ecscad wird mit...
ecscad.ch Ecscad Stromlaufpläne Mechatronik Planung Cad Software Schaltpläne Instandhaltung Daten Support Elektro Ob Cae Stellt Projekte Struktur Français Vorliegenverschmelzung
65 Catalea Fashion - Bekleidung Bekleidung Großhandel at
5101
Bergheim bei Salzburg
Catalea Fashion - Bekleidung Großhandel für Wiederverkäufer. Von Damenmode bis zu Taschen, Accessoires u.v.m. Qualitätsmode Großhandel für gewerbliche Kunden....
cataleafashion.com Großhandel Uns Taschen Fashion Bekleidung % Textil Accessoires Sommerkleid Free Catalea Damenmode Shop Mein Konto Mäntel
66 Die besten Siebträgermaschinen im Vergleich Die besten Siebträgermaschinen im Espressomaschinen at
9560
Feldkirchen in Kärnten
Alle Infos über aktuelle Siebträgermaschinen: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
siebtraegermaschinen-vergleich.com/
67 Die besten Siebträgermaschinen im Vergleich Die besten Siebträgermaschinen im Espressomaschinen at
9560
Feldkirchen in Kärnten
Alle Infos über aktuelle Siebträgermaschinen: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
siebtraegermaschinen-vergleich.com/
68 Die besten Flachbettscanner im Vergleich Die besten Flachbettscanner im Scanner at
2340
Mödling
Alle Infos über aktuelle Flachbettscanner: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
flachbettscanner-vergleich.de/ Flachbettscanner Vergleich Canon Epson Mwst Kauf Preis Software Hersteller Fotoscanner Avision Kaufen Scanner Dokumentenscanner Test Multifunktions Druckern Ratgeber Iochow Fazit Bandbreite
69 CBD & Superfood Onlineshopping ch
3507
Biglen
Liebhaber von Hanfprodukten, die in der Schweiz leben oder hier über eine Postadresse verfügen, haben gut lachen: Produkte auf Basis...
mrhemp.ch
70 Brennholz Kaminholz Brennholz Kaminholz at
9135
Bad Eisenkappel
Splitterfrei, sauber, unter 18% Feuchtigkeit. Mit unserem österreichischen Holz wird Heizen zum Vergnügen. Zustellung österreichweit....
buchen-brennholz.at Here Directions Brennholzat | Agb Wwwbuchen Httpwwwtraussnigat Warmesoffice@buchen Behagliches Wohnen Extras + Preise
71 Kreditvergleich24 Finanzen ch
8304
Wallisellen
Kredit Vergleich 24 ist die seriöse Finanzierungsgesellschaft betreffend Finanzierungen, Darlehen und mehr. Bezüglich Kredite bieten wir unter anderm Kleinkredite sowie...
kreditvergleich24.ch/ Schweiz Kredit Kreditvergleich Günstige Privatkredit Sofortkredit News Kredite Beantragen Kleinkredit Kleinkredite Funktionert Unternehmen Privatkredite Kreditantrag Zürich West
72 Suchmaschinenoptimierung · SEO SEO at
6500
Landeck
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
73 Sichtschutz Zauntechnik at
2333
Leopoldsdorf bei Wien 
M-tec technology Sichtschutz in Österreich Bei M-tec technology GmbH finden Sie Zaunblenden zum blickdichten Einflechten in Ihren Gittermattenzaun. Wählen Sie...
m-tec-sichtschutz.at/ Tec Pvc Sichtschutz Einflechten Sichtschutzstreifen Profi Design Line Streifen Muster Zaunblenden Print Hart Shop – Erfolg
74 Suchmaschinenoptimierung · SEO SEO at
6500
Landeck
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
75 Suchmaschinenoptimierung · SEO SEO at
6500
Landeck
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
76 PREISJASSEN Jassturnier ch
4058
Basel
Samstag, 23. Sept. 2017 Im ehemaligen Rest. Alexander heute Rest. Pizza Blitz Riehenring 85 4058 Basel Besammlung 13:30 Uhr Beginn...
77 PREISJASSEN Jassturnier ch
4058
Basel
Samstag, 23. Sept. 2017 Im ehemaligen Rest. Alexander heute Rest. Pizza Blitz Riehenring 85 4058 Basel Besammlung 13:30 Uhr Beginn...
78 Prime Models | die Modelagentur ch
9000
St. Gallen
Wir von Prime Models sind die Modelagentur wenn es um Vielseitigkeit, Geschwindigkeit, Kreativität und Einzigartigkeit geht. Lassen Sie sich positiv...
prime-models.ch/
79 Oberwaid Private Clinic Private Clinic ch
9016
St. Gallen
Oberwaid is a luxury wellness hotel situated near the beautiful Lake Constance. Apart from luxury accommodation, its private clinic has...
oberwaid.ch/privatklinik/medizin-gesundheit.html Oberwaid Privatklinik Medizin Gesundheit Hotel Gesund Team Behandlungskonzept Patienten Therapieangebot Swiss Indikationen Kur Photohrapher Coaching Oase Traditionelle
80 Wohnboutique.ch - Online Shop Haushalts- und ch
4133
Pratteln
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
wohnboutique.ch
81 Praxis Krebs & Martin Zahnarzt ch
6006
Luzern
Ihre Zahnärzte und Spezialisten für Implantate in Luzern. Das gesamte Spektrum der Zahnmedizin. Mit Erfahrung von über 5000 gesetzten Implantaten....
zahnarzt-praxis-luzern.ch Dr Krebs Martin Luzern Zahnarzt Zahnmedizin ✚ Termin Implantate Erfahrung Server English Angstpatienten Prothesenhalt Weisheitszähne
82 Partnerseminar Seminar at
2880
Kirchberg am Wechsel
GÖNNEN SIE SICH EIN WOCHENENDE NUR ZU ZWEIT !! Verliebt zu sein – reicht es für eine gute Partnerschaft aus ? Jeder...
positive-sense.at Mentaltraining Kinesiologie Birkenbihl Vera Jugendliche Unternehmen Mobbing Kinder Lernen Balance Gehirngerechtteam Arbeiten Gelassenheit
83 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
6017
Ruswil
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
ws-wasserenthaertung.ch
84 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
6017
Ruswil
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
ws-wasserenthaertung.ch
85 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
6017
Ruswil
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
ws-wasserenthaertung.ch
86 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
6017
Ruswil
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
ws-wasserenthaertung.ch/
87 Priv. Doz. Dr. med. Plastische und ch
4051
Basel
Mein Spezialgebiet in der Praxis für Plastische und Ästhetische Chirurgie ist die plastische und ästhetische Brustchirurgie und Körperchirurgie. Auf diesem...
plastische-chirurgie-in-basel.ch Dr Med Erfahren Chirurgie Brust Spezialisten Doz Gesicht Priv Kosten | Torio Körper Iblher Voigt Info@plastische Baselch
88 Priv. Doz. Dr. med. Plastische und ch
4051
Basel
Mein Spezialgebiet in der Praxis für Plastische und Ästhetische Chirurgie ist Gesichts- und Nasenchirurgie. Ich habe 2010 meinen Facharzttitel für...
plastische-chirurgie-in-basel.ch Med Erfahren Dr Brust Spezialisten Priv Gesicht Chirurgie Doz Torio Kosten Jameda Körper Iblher Voigt Info@plastische Baselch
89 Prof. Dr. med. Nestor Plastische und ch
4051
Basel
2009 erlangte Prof. Dr. med. Nestor Torio seinen Facharzttitel für Plastische und Ästhetische Chirurgie. Zwischen 2009 und 2014 war er...
plastische-chirurgie-in-basel.ch Erfahren Dr Med Chirurgie Gesicht Spezialisten Brust Doz Priv Iblher Torio Jameda | Kosten Körper Baselch Info@plastische
90 Ried Verpackungssysteme GES.M.B.H Verpackungen at
5020
Salzburg
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
ried-foodpack.at
91 Ried Verpackungssysteme GES.M.B.H Verpackungen at
5020
Salzburg
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
ried-foodpack.at
92 Ried Verpackungssysteme GES.M.B.H Verpackungen at
5020
Salzburg
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
ried-foodpack.at
93 Verband Schweizerischer Laien- und Berufsverband ch
4310
Rheinfelden
Der VSLFR setzt sich für die Mitwirkung von Fach- und Laienrichtern im Justizsystem und für die Förderung der Kompetenzen seiner...
vslr.ch Z Vslr Y
94 Praxis für Plastische Chirurgie Plastische und ch
4051
Basel-Stadt
Unsere Praxis zählt zu den führenden Zentren für Plastische und Ästhetische Chirurgie in der Nordschweiz und verfügt über modern ausgestattete...
plastische-chirurgie-in-basel.ch Med Erfahren Dr Priv Brust Doz Gesicht Chirurgie Spezialisten Körper Kosten Jameda Torio Iblher Voigt Info@plastische Baselch
95 SchleifMaster - Friseurscheren Schleifservice SchleifMaster - Friseurscheren Schleifservice Schleiferei at
42657
Solingen
Die Firma SchleifMaster aus Solingen ist Ihr professioneller Friseurscheren-Schleifservice. Wir sind auf das Schleifen und Reparieren von hochwertigen Friseurscheren spezialisiert. Ob Scheren...
friseurscheren-schleifservice.at Schleifen Scheren Friseurscheren Schleifauftrag Preise Joewell Schliffarten Auftrag Leader + Schleifservice Linkshandscheren Hohlschliff Diavolo Cam✓ Japanische
96 Hochzeit-selber-planen Dienstleistung at
4020
Linz
Alles rund um Ihre perfekte Hochzeit finden Sie auf unserer Seite. Alles was Sie nur brauchen können Sie in unserem...
hochzeit-selber-planen.com Hochzeitsplanung Hochzeit Flitterwochen Tipps Hochzeitsspiele Knigge Trauung Hochzeits Hochzeitsplaner Hochzeitstorten Hochzeitsgäste Planen Catering Hochzeitskosten Hochzeitsbräuche Ratgeber Hochzeitsfest
97 pure life – Zentrum Ernährung at
5020
Salzburg
Das pure life Salzburg ist das Kompetenzzentrum zum Thema Ernährung, metabolic balance Stoffwechselprogramm, Stoffwechselkur, gesund abnehmen sowie Nahrungsergänzung und Beratung...
pure-salzburg.at/ Pure Salzburg Life Ernährung Vita Conny Youtube Rezepte Metabolic Hörl Club Balance Kompetenzzentrum Gtgt Abnehmen Radikale Testungen Hcg Diät Light Gesunder Innerhalb
98 prime Kosmetikstudio Salzburg Kosmetikstudio at
5020
Salzburg
Kosmetikstudio in Salzburg Stadt für professionelle Beauty und Kosmetik Behandlungen gesucht? Prime bietet nicht nur Gesichtbehandlung, Microdermabrasion, Make-Up, Haarentfernung und...
prime.at/
99 Online Shop für Hanf Lebensmittel Tabak ch
3507
Biglen
Mr. Hemp ist dein schweizer Onlineshop für CBD und Hanfprodukte in der Schweiz. Wir bieten eine grosse Auswahl an CBD...
mrhemp.ch Cbd Mrhemp Bieten Cannabis Mr Uvmneu Amp Sonnenfeld Schweiz Hanfnatur Hemp Superfoodmrhemp Lebensmittel Marken Hanfoumll Budz
100 Wespen Notdienst Schädlingsbekämpfung at
9020
Klagenfurt
Ihr Spezialist für Wespen und Hornissen Evakuierungen und Bekämpfung in Kärnten!...
vespix.at Valid Wespen Umsiedelungen Klagenfurt Vespix Wölfnitz Steinacher Xhtml Insektenbefall Hummeln Wespenbekämpfung Hornissenstiche Preise Inhaber Hornissenbekämpfung Zuhause Wespennotdienst Css
101 InCoFin GmbH & Co.KG Finanzberater Finanzberatung ch
45663
Recklinghausen
Ihr Berater in Sachen Finanzen aus Recklinghausen. Seit mehr als 15 Jahren unterstützen wir Konsumenten beim auswählen von korrekten Vorsorge-...
unabhaengiger-finanzberater.de Ort Sparen Berater Uns Portal Honorarberatung Erfolgreich Finanzberatung Beratungsabläufe Unabhängige Unabhängiger Vermögen Finanzberater Eigenkapitalbeschaffung Altersvorsorge Ihr Kredite
102 Tourismusverband Goldegg am See at
5622
Goldegg
Wer unvergessliche Ferien in Salzburg erleben will, der checkt ein für einen Urlaub in einer der Unterkünfte in Goldegg am...
goldeggamsee.at/ Goldegg See Goldegger Kultur Genuss Tradition Familie Erlebnis Romantik Urlaub Tour Unterkünfte Golfen Wandern
103 Logo Erstellung zum günstigen Logo Design ch
8143
Stallikon
Filogo ist eine kleine Design Agentur mit Sitz in der Schweiz, welche sich auf das Erstellen professioneller Logos für Firmen...
filogo.ch
104 Überwachungskamera Set Ratgeber at
2512
Tribuswinkel
Wir bieten einen Ratgeber zum Thema Überwachungskamera Set. Wir stellen unterschiedliche Typen von Überwachungskameras vor und erklären die Vor- und...
ueberwachungskamera-set.org Wlan Mwst Kaufen Winkel Set Kabel Dome überwachungskamera Modelle Netgear Arlo ° Kameras Außen Innen Modell Ptz Fähig Bauart Ptz Fähig Wandarm Dome Wandarm Innen Hd Aufzeichnung Kamera Die Anwendungsfälle
105 Finest Homes Immobilien Salzburg Immobilien at
5020
Salzburg
Finest Homes bietet Luxusimmobilien in der Stadt Salzburg ebenso wie im Salzburger Land im Seengebiet und im Salzkammergut. Informieren Sie...
finest-homes.com/ Salzburg Wohnungen Grundstücke Häuser Verkaufte Homes Seeliegenschaften Finest Villen Neubauimmobilien Bauernhäuser Penthousewohnungen Land Luxusimmobilien Immobilien Wertermittlung Verkauf Stadt Uns
106 Finanzielle Hilfen Dringende für Investor Gesucht ch
1000
Lausanne
Sehr geehrter Kreditsuchender, Ich biete von Darlehen in der Höhe von 1000 € bis 10.000.000 € für Privatpersonen und Unternehmen...
107 Mehr Ihre Bank für Finanz at
8292
Burgenland
Hallo Herr und Frau .; Sie suchen entweder heben Sie Ihre Aktivitäten für die Finanzierung, ob für ein Projekt oder eine...
12
108 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
5020
Salzburg
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
dr-scherer.at/
109 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
5020
Salzburg
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
dr-scherer.at/
110 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
5020
Salzburg
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
dr-scherer.at/
111 schlau-finanziert Finanzierungsvermittlung GmbH Finanzierungsvermittlung at
5110
Oberndorf b. Salzburg
schlau finanziert – Wir vergleichen Konditionen Für Ihre Immobilienfinanzierung vergleichen wir als unabhängige Finanzierungsvermittler Angebote von über 50 Banken und Bausparkassen....
schlau-finanziert.at/ Partner Miete Eigentum Vergleichen Berechnen Kreditumschuldung Finanzierungsanfrage Kreditrate Budgetrechner Kreditrechner Immobilienfinanzierungen Besten Förderungen Finanziertat Beratung Bau Zahlen
112 Finanzdienstleistung für verwirklichung ihrer Angebote ch
9706
Clervaux
Zur Realisierung Ihrer Projekte bieten wir die Möglichkeit der kurzfristigen Kredite an mittel mit einem flexiblen Tilgungsplan und einem jährlichen...
12 rue de nice
113 Fotostudio Gianni Groppello Fotografie ch
4051
Basel
Gianni Groppello ist ein Fotograf aus Basel, der im Jahr 2007 seine Leidenschaft zum Beruf gemacht hat. In diesem Jahr...
gianni-groppello.com Z Y
114 Künstlerische Fotografie Fotografie at
3100
3100 St. Pölten
Meine bevorzugten Themen sind Porträt-Fotografie, Spirituelles, Natur-und Makrofotografie, People/Children-Fotografie, Experimente, Impressionen, Fotoreisen. ​Seit 6 Jahren leite ich Foto-Workshops für Jugendliche an...
jaeggi-fotoart.com Fotografie Workshops Experimente Foto Children Spirituelles People Waldviertel Nude Impressionen Reisen Galerie News Nordalbanien Ua Hin Landschafts Erstreckt
115 Spin IT IT EDV at
7442
Lockenhaus
Wir bieten individuelle und kostengünstige IT Lösungen für Klein- und Mittelbetriebe. (Web- und Grafikdesign, Verarbeitung von Geodaten, Netzwerk und Server...
spin-it.at Spin Server Sicherheit Entertainment Reparatur Virenschutz Dienstleistungen Geoinformationssysteme Konfiguration Netzwerk Spindler Notebook Pc Backup Computer Virtualisierung Wlan Geräteund
116 Hotel in Grindelwald Hotels ch
3818
Grindelwald
Wichtig für Ihre schönen Reise- und Urlaubserlebnisse ist auch die Wahl des richtigen Hotels. Deswegen bieten wir Ihnen als Kooperation...
hotel-in-grindelwald.com/ Grindelwald Scheidegg Restaurant Ferienregion Hotel Gastronomie Jungfrauregion Kleine Berner Jungfraujoch Unesco Welterbe Hotels Grosse Wanderwege Grindelwalder Aussichtspunkte Europe Zahlreichen
117 Autoglas Mobil Service Landshut Autoreperatur ch
84032
Landshut
Autoglas Landshut, Straubing, Mauern, Moosburg, Freising, Erding. Heimservice für Windschutzscheiben, Frontscheiben o. Heckscheiben. Windschutzscheiben repair. Scheibenwechsel, Autofenster reparieren, wechseln....
autoglas-bayern.de Autoglas Heimservice Landshut Straubing Windschutzscheiben Partner Moosburg Deggendorf Terminvereinbarung App Regensburg Versicherungen Qualität Leihwagen Sonnenschutz Store Eching Wörth
118 PROTECARS - The good Limousinen Service ch
4058
Basel
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
protecars.ch/
119 PROTECARS - The good VIP Shuttle ch
4058
Basel
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
protecars.ch/
120 PROTECARS - The good VIP Shuttle ch
4058
Basel
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
protecars.ch/
121 Hypnose-Therapie Gesundheit Pschologie ch
4460
Gelterkinden
Nutzen der Therapie: Sie lösen ihre Ängste, Phobien und Blockaden auf Sie steigern ihr Selbstvertrauen und maximieren ihren Selbstwert Sie werden Rauchfrei oder...
step-up-now
122 Motomi GmbH | Gebrauchtwagenbörse Gebrauchtwagenhandel at
9020
Klagenfurt am Wörthersee
Gebrauchtwagenbörse für Händler und private Verkäufer. Bis zu 2 Fahrzeuge gratis inserieren. Autobörse für Gebrauchtwagen, Jahreswagen und Vorführwagen der Marken...
gebrauchtwagen-neuwagen.at Volkswagen Vw Golf Vii Variant Gebrauchtwagen Kärnten Auto Händler Leasing Kaufen Börse Passat Autos Ford Skiurlaub
123 Kookaburra Australia Work And ch
9000
St. Gallen
Wir bringen Dich nach Australien! Im Rahmen des Kookaburra Projekts organisieren wir Auslandaufenthalte für Handwerker und Bauarbeiter aus der Schweiz...
kookaburraaustralia.ch Australien Kookaburra Leben Australia Projekt Handwerker Dein Dich Abenteuer Deine Beratung Angebot Bauarbeiter Gratis Deutschland Deinem Unserem Grundkenntnisse Jobs Damit
124 SMBS University of Salzburg Ausbildung at
5020
Salzburg
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
smbs.at/
125 SMBS University of Salzburg Ausbildung at
5020
Salzburg
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
smbs.at/
126 Direkt Kommunikation Lebens-und Sozialberatung at
9500
Villach
Ehrliche, humorvolle und authentische Kommunikation, Beratung, Mediation von und mit Anna Maria Michenthaler aus Villach...
lebensberatung-kaernten.com Anna Michenthaler Mariay
127 bieten Darlehen zwischen bestimmten Darlehen at
9500
Villach
Kreditangebot für Firmen, Unternehmen und jeder Person von gutem Charakter kann seine Verpflichtungen mit einem erschwinglichen Preis von 3% entsprechen....
rue francfort
128 abc Sprachen Education ch
8304
Wallisellen
ABC-Sprachen steht für Individualität, Flexibilität und beste Lernerfolge. Die ausgebildeten und zertifizierten Fachkräfte unterrichten ausschliesslich in ihrer Muttersprache. Wählen oder...
abcsprachen.ch Halbprivatkurse Privat Sprachkafi Sprachtandem Konversationskurse Gruppenkurse Sprachen Diplomkurse Kurse Lehrkräfte English Abc Englisch Stolz Arbeitsplatz Fordern
129 Tierklinik Neusiedl Tierklinik Neusiedl Tierklinik Tierarzt at
7100
Neusiedl am See
Therapiezentrum für Ganzheitsmedizin Das Hauptaufgabengebiet der Tierklinik NEUSIEDL ist es - gemeinsam mit unseren speziell ausgebildeten Tierärzten - für das Wohl...
tierklinik-neusiedl.at Neusiedl Notfall Tierklinik ärzte Tieres Ihres See Aktuell Gesundheit Leistungen + Team Fragen Vorsorgeuntersuchung Datenschutzerklärung Bildgebende
130 Prim. Dr. Harald Simader Internist Ärzte at
5026
Salzburg-Aigen
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
simader-internist.at
131 Prim. Dr. Harald Simader Internist Ärzte at
5026
Salzburg-Aigen
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
simader-internist.at
132 Dormis Ferienwohnungen Ferienhäuser at
10783
Berlin
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Book Apartment Companies How Additional Other Listing Affiliate Owners Policy Engine Program Deming Rome Submit London Worldwide Apartments
133 Dormis Ferienwohnungen Ferienhäuser at
10783
Berlin
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Apartment Book Listing Other Apartments Policy Program Companies Additional Engine Owners Affiliate Filter Welcome
134 Hotel Schloss Leopoldskron Hotel at
5020
Salzburg
Als Schlosshotel am See ist Hotel Schloss Leopoldskron sowohl traumhaftes Luxushotel für Urlaub in Salzburg, als auch außergewöhnliche Eventlocation für...
schloss-leopoldskron.com/ Schloss Salzburg Leopoldskron Hotel Seminare Suiten Veranstaltungen Eventlocation Park Zimmer Events Konferenzen Heiraten Music Feiern Garten Max Traum Partner
135 HML Beleuchtung LED Beleuchtung at
5340
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
hml-beleuchtung.at Beleuchtung Hml Led Küche Bad Produkte Schlafzimmer Garten Vorraumräume Datenschutzerklärung Büro Pool Spa
136 HML Beleuchtung LED Beleuchtung at
5340
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
hml-beleuchtung.at
137 Hörgeräte Berlin Hörgeräte at
14199
Berlin
Hornig Hörgeräte Berlin - Besuchen Sie uns und lassen Sie sich professionell beraten....
hornig-hoeren.de/
138 Schmidt Bio logisch Reinigung & ch
8636
Wald
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
reinigung-schmidt.ch
139 Schmidt Bio logisch Reinigung & ch
8636
Wald
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
reinigung-schmidt.ch
140 Kavalierhaus Klessheim - Eventlocation Eventlocation at
5071
Wals-Siezenheim
Die Eventlocation Kavalierhaus Klessheim in Salzburg bietet Veranstaltungsräume und Seminarräume zum Mieten oder Buchen für Veranstaltungen wie Firmenfeiern, Firmenveranstaltungen oder...
kavalierhaus.at/
141 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
9020
Klagenfurt
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
gebrauchtwagen-neuwagen.at
142 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
9020
Klagenfurt
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
gebrauchtwagen-neuwagen.at
143 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
9020
Klagenfurt
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
gebrauchtwagen-neuwagen.at
144 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
9020
Klagenfurt
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
gebrauchtwagen-neuwagen.at
145 Salon de Coiffure Coiffure ch
1003
Lausanne
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
stilecreativocoiffure.com
146 Salon de Coiffure Coiffure ch
1003
Lausanne
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
stilecreativocoiffure.com
147 Uniresidence Alloggi Studenti ch
6900
Lugano
Residenza con appartamenti arredati e climatizzati a Lugano vicino all Università . Appartamenti per studenti USI e SUPSI , lavoratori...
uniresidence.ch Appartamenti Uniresidence Lugano Studenti Contatto Usi Per Residenza Climatizzaticoppie Procedura Ammobiliati Assigned Punti
148 vita club Salzburg West Fintessstudio at
5071
Himmelreich
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Salzburg Gtgt Fitnessstudio Training Fitnesscenter Fitnessclub Fitness Ebenso Trainingsplan Beratung Plate Spinning
149 vita club Salzburg Nord Fintessstudio at
5020
Salzburg
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Fitness Salzburg Fitnessclub Fitnessstudio Training Fitnesscenter Gtgt Spinning Power Sauna Ebenso Trainingsplan Gesundheitlichen
150 vita club Salzburg Süd Fintessstudio at
5020
Salzburg
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Training Fitnessstudio Gtgt Fitness Salzburg Fitnesscenter Fitnessclub Coaching Spinning Yoga Geräte Gesundheitlichen Trainieren Ausdauertraining
151 Zusatzunterricht im Raum Zwettl Bildung und at
3910
Zwettl
Mathematik, Physik, Softwareentwicklung, Netzwerktechnik, Systemtechnik Für Dich: Langfristig/Kurzfristig, Auffrischung/Notfallmanagement, Zusatzunterricht/Hausübungsbetreuung, Altlastbereinigung/Vorbereitung....
mobiler-mathe-trainer.at
152 Private Geld Kreditgeber hier Darlehen ch
10115
Berlin
Postfinanzierung ist eine amerikanische Privatkreditgesellschaft, die seit 1996 in den USA gegründet wurde und Finanzierungslösungen für alle Einzelpersonen, Firmen und...
privát pénz hitelező itt elérhető (nincs előtörlesztés)
153 Nebenjob Heimarbeit ch
9244
Niederuzwil
Stellen Sie sich vor wie das wäre wenn Sie von zu Hause aus arbeiten könnten? Sie haben freie Zeiteinteilung. Leistungsgerechte...
gesundheitsplattform.ch Therapeuten Firmen Leute Arbeit Aging Qualifikation Schweiz Nahrungsergänzung Gesundheitsplattformch Vfg Gesundheitsplattform Spurenelement Tragen Fit Wellaging Antiaging Y
154 HTK-Vent - Spezialist für Industrieventilatoren at
3400
Klosterneuburg
HTK-Vent ist der Spezialist für Industrieventilatoren der Marke VENTUR in Österreich. Im Sortiment von HTK-Vent finden sich klassische Axial- und...
htk-vent.at/
155 Alpaka Trekking am Berg Trekking ch
4534
Flumenthal
Alpaka, Lama und Esel Trekking auf dem Solothurner Jura oder wo immer Sie möchten oder zusammen mit den Alpakas in...
alpaka-am-berg.ch Alpaka Trekking Spass Tieren Herrmann Berg Lama Macht Jura Eseli Balmberg Erlebnis Esel Seit Alpaca Tiere
156 Erwin Leimlehner Fotografie Fotografie Hochzeitspanorama at
4052
Ansfelden
Hochzeitsfotografie mit 360° Hochzeitspanoramen, die als Bildschirmschoner oder in Web-Seiten eingebunden werden können. Auch virtuelle Touren durch interaktive 360° Panoramen....
leimi01.wixsite.com/leimlehner-foto Bildschirmschoner Hochzeitspanorama Hochzeitspanoramenhochzeitsfotografie Traumhochzeit Erlebnisfotografie Degpanorama Interaktive Deg Panoramenbilder Leimlehner Erwin
157 TCM Praxis ROTGOLD-Akupunktur Naturmedizin ch
4806
Wikon / LU
Traditionelle chinesische Medizin / Naturmedizin Akupunktur Phytotherapie Moxibustion Schröpfen Massagen Ernährungstherapie Rejuvenation/Wirkungsvolle Verjüngungs-Akupunktur NOVALENICs Innovative naturmedizinische Galenik KOMPETENT & INDIVIDUELL SEIT 1998...
rotgold.info Akupunktur Gong Schröpfen Qi Tcm Moxibustion Kommunikation Rejuvenation Novalenic Philosophie Portrait Materia Naturmedizin Medica Kooperation Arzneien Verkauf
158 Hochzeitsmusik Hochzeitsmusiker Hochzeitsbands Hochzeitsmusiker Künstlerverzeichnis Musiker at
3250
Wieselburg
Sie planen eine Hochzeit, eine Party, ein Zeltfest, einen Ball oder eine andere Veranstaltung? Auf EinTollesFest.at finden Sie die passende Bands...
eintollesfest.at/de/
159 Detektivbüro Salzburg | Richard Detektei at
5020
Salzburg
Detektiv Wallner ermittelt diskret, zuverlässig und professionell in jedem österreichischen Bundesland. Wir sind rund um die Uhr für Sie erreichbar...
detektei-wallner.at/ | Detektiv Wien Graz Baden Wallner Privatkunden Salzburg Kontrolle Geschäftskunden Richard Magiur Verbinden Jurist Patentrecht Außendienstes Häufige Apache
160 FUMAR.CH Zigarrengeschäft Tabakwaren ch
8180
Bülach
FUMAR.CH ist ein schweizer Fachgeschäft mit einem grossen Zigarrensortiment. Wir führen in unserem Online-Shop über 1000 verschiedene Zigarren und bieten...
fumar.ch Zigarren Entdecken Cutter Davidoff Pfeifen Aschenbecher Zigarre Zigarillos Partagas Julieta Tabak Feuerzeuge De Humidore Montecristo Herkunft Mexiko Aufbewahren Romeo
161 HÖLZL & HUBNER Gewerbeimmobilien Immobilien at
5020
Salzburg
HÖLZL & HUBNER Immobilien bietet Anlageobjekte, Renditeobjekte sowie Gewerbeimmobilien in Salzburg. Als Gutachter erstellt HÖLZL & HUBNER Immobilienbewertung und Gutachten...
hh-immo.at/ Immobilien Hubner Hölzl Büros Gutachten Gewerbeimmobilien Wohnimmobilien Renditeobjekte Anlageobjekte Salzburg Gewerbe Wohnbaugrundstücke Unternehmen Hotels Geschäftslokale Miete Grundstück Büroräume Gastronomiehotels Objektsuche
162 Hypnosetherapie Hypnose Coaching ch
5436
Würenlos
createyourself.ch Coaching Praxis Hypnosetherapie Hypnose Energie Beratung Alten Prozesse Angst Erfolg Wahrnehmung Hypnosetherapie Während Preis Thetafloating” Weiseverändern Beratung Wingwave
163 Psychosoziale Spitex Spitex Ambulante ch
5436
Würenlos
Psychosoziale Spitex -Mehr als nur eine Begleitung Haben Sie gerade einen Klinikaufenthalt hinter sich und möchten nun eine professionelle und kompetente...
psychosoziale-spitex.ch Spitex Betreuung Professionelle Psychosoziale Unterstützung Zuhause Umgang Hause Einzelwohnen Angelina | Nachbetreuung Klinikaufenthalt Begleitetes Ort Alltag Leistungen Toggle Seifert
164 Wir schützen Ihre Werte Objektsicherheit Datacenter ch
5507
Mellingen
Objektsicherheit plant, baut und betreibt Sicherheitsobjekte für Kunden in der ganzen Schweiz. Wir stehen als Spezialisten für alle Belange...
objektsicherheit.ch
165 Elektrische Motorkarre Schiebetruhe Schubkarren. Garten at
3631
Kirchschlag
Motorkarre mit Motor, verschiedene Ausführungen und Zubehör möglich- Schneeschild, Gabel, Schubkarre, Elektrofahrräder, Gartengeräte, Häcksler, Mini Dumper mit Elektroantrieb und mit...
bravoschubkarre.eu Motorkarre Mini Dumper Motorkarren Elektro € Elektrische Zubehör Benzinmotor Elektrofahrräder Komplettpreis Häcksler Ladeschalen Beschreibungen Katalog Download
166 Kinesiologe Bachblütenberater Persönlichkeitsanalyse Gesichter Kinesiologe Gesundheit at
5020
Salzburg
Kinesiologie, Bachblütenberatung, Persönlichkeitsanalyse. Dient zum Stressabbau, Depression, völlige Erschöpfung, Managerkrankheiten, Allergien lösen....
lolawerkstatt.eu Z Meinewebsite Y
167 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
59929
Brilon
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
weber-gutachter.com
168 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
59929
Brilon
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
weber-gutachter.com
169 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
59929
Brilon
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
weber-gutachter.com
170 Reinigung - Umzug - Reinigung ch
4600
Olten
Unsere Erfahrung und ein ständig angepasstes Dienstleistungsangebot machen uns stark dafür, wenn es um bedarfsgerechte Lösungen, flexibles Zeitmanagement und kundenorientierte...
silver-reinigung.ch Reinigung Umzug Entsorgung Silver Reinigungsarbeiten Qualität Unternehmen Mengen Schnell Umzüge Kenntnisse Partner Zufriedenheit Galerie Spezialgeräten
171 Minnei Fotografie ch
4900
Langenthal
Hobbyfotografin für Ihre Anlässe oder Tieraufnahmen...
fotosfuerimmer@jimdo.com
172 Telefonanlagen und Telefonanschluss Shop Telekommunikation at
5020
Salzburg
Im Shop von Telefonanlagen Lieferant finden sich ISDN & VoIP Telefonanlagen zum Kaufen sowie diverse Telefonanschlüsse, die dort beantragt werden...
telefonanlagen-lieferant.at/ Telefonanlagen Isdn Internet Telefonanschluss Panasonic Voip Telefon Cloud Telefonie Sms Provider Sip Ip Shop Beratung Businesskunden Voice Technologie Beratungs Check__
173 Studio Wimperntraum Wimpernverlängerungen Kosmetik at
12109
Berlin
Sie wollen einfach schöne Wimpern , dann ist Ihr Salon Wimpern-Traum in Berlin - Mariendorf Ihr kompetenter Experte...
wimpernverlaengerungen-berlin.de/ Wimpern Berlin Wimpernverlängerung Studio Wimpernwelle Schöne Lash Eyelash Einfach Wimpernverdichtung Technik Tempelhof Extensions Natur Auswahl Geschlossen
174 Bauerndörfl Rindereben - Ferien Tourismus at
5612
Hüttschlag
Wer seinen Urlaub inmitten der traumhaften Naturkulisse des Nationalpark Hohe Tauern verbringen möchte, liegt mit dem Bauerndörfl Rindereben genau richtig....
rindereben.at/ Bauerndörfl Open Rindereben Hüttschlag Grossarltal Gallery Personen Feriendorf Bauernhof Berg Bauernhaus Angebote Großarltal Lage Ferienwohnung Gesund Advent Bio Blockhaus
175 Nature Adventure - Canyoning Outdoorsport at
6652
Elbigenalp
Wir bieten geführte Outdoorsporttouren an und haben uns auf Canyoning, Rafting und Mountainbike spezialisiert. Zu Hause im Tiroler Lechtal, einer...
nature-adventure.at Canyoning Rafting Nature Adventure Lechtal Lech Programm Neuigkeiten Specials Tirol Galerie Bike Video Touren Mountain
176 Restaurant Nektar Restaurant ch
9000
St Gallen
Persönlich-Gemütlich-Klein Ein paar Worte, die uns beschreiben sollen....
restaurant-nektar.ch
177 Sandra Wolkerstorfer - Psychotherapeutin Psychotherapie Linz at
4020
Linz
Psychotherapeutin in Linz, Kinder- und Jugendpsychotherapie...
therapie-beratung.at Webseite … Archiv Wolkerstorfer Psychotherapeutische Praxis Psychotherapeutin Sandra Linz Ba Leistungen Beratung überspringen Erziehungsberatungpsychotherapie
178 Familien- und Vitalhotel Auenhof Hotel at
6166
Fulpmes
Herrlich ruhig und grün gelegen, bietet Ihnen unser Hotel Auenhof alle Möglichkeiten für einen traumhaften Familienurlaub im Stubaital in Tirol....
auenhof.at + Anreise Familien Vitalhotel Auenhof En Hotel@auenhofat Tiroler Geniessen Apache Auenhof****hotel Relax Wertvollsten
179 Salzburg Convention Bureau Eventveranstalter at
5020
Salzburg
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
salzburgcb.com/
180 Salzburg Convention Bureau Eventveranstalter at
5020
Salzburg
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
salzburgcb.com/
181 Salzburg Convention Bureau Eventveranstalter at
5020
Salzburg
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
salzburgcb.com/
182 Dipl. Hypnosetherapeutin OMNI NGH Hypnosetherapie ch
5507
Mellingen
Hypnosetherapie bei Stress, Gewichtsreduktion, Allergien, Ängsten, Chronischen Schmerzen, Sportlichen oder Beruflichen Zielsetzungen uvm. Ein starkes und glückliches Leben durch: MENTALE / EMOTIONALE...
hypnosetherapie-ld.ch Hypnose Stress Abnehmen Allergien Hypnosesitzung Schmerzen Diriwchter Hypnosetherapie Luzia Hypnosetherapeutin Bulimie Unterbewusstsein Praxis Themen Unruhe Patienten Essen Termin Finden Hilfe
183 Willkommen auf der Tigereye-mine.com Mineralien & at
6410
Telfs
Das Tigerauge gehört zu einem begehrten Schmuckstein, hat sich im Laufe der Jahre zu einem bei Esoterikern und Mineralienfans gleichermaßen...
tigereye-mine.com Tigers Mine Grades Order Mining Eye Also Avenue Florida Wholesale Order@tigereye Inc Minecomstates
184 Die fasziniernde Welt des Mineralien & at
6410
Telfs
In Osteuropa, im südlichen Kaukasus befindet sich die bisher einzigen, bedeutenden Vorkommen dieser Obsidian-Varietät. Auch andere Obsidian-Arten sind dort gefunden...
lamellenobsidian.com Lamellenobsidian Obsidian Heilstein Lamellen Form Obsidians Lace Midnight Gutachten Kristalle Gestein Anteile Besonderheit Bildergalerie Stck Hinsicht Bann
185 Handyzubehör und Handyersatzteile günstig Handyzubehör Mobiltelefonie ch
2504
Biel
Reparatursets und die dazugehörigen Ersatzteile für Handys und Tablets gibt es nur im Schweizer Onlineshop andbox.ch. Zusätzlich bietet der Shop...
andbox.ch/ Apple Iphone Oem Galaxy Schwarz Xperia Samsung Plus Zubehör Sony Nexus Smartphone Hüllen Htc Reparatursets Usb Sticks Handyersatzteile Hörmuschel Kopfhörer
186 Bücheler Werbegeschenke AG Werbeartikel ch
8912
Obfelden
Bücheler AG - Der Werbeartikel-Spezialist mit Werbeartikeln aller Art Streuartikel, edle Werbepräsente, Kundengeschenke, Give aways, Werbeartikel für Messen und Ausstellungen Ihre...
buecheler.ch Werbeartikel Bücheler Profi Werbegeschenke Etui Streuartikel Give Farben Kunststoff Sonnenbrille Flop Trinkflasche Tasse Wwwpromotrendsch Werbeartikelprofi Kundengeschenk Ipad Hülle Werbe
187 Babycenter Schweiz Baby-Produkte ch
3322
Urtenen-Schönbühl
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
babycenterschweiz.ch/
188 Babycenter Schweiz Baby-Produkte ch
3322
Urtenen-Schönbühl
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
babycenterschweiz.ch/
189 Institut für Logotherapie & Logotherapie at
5020
Salzburg
Das Institut bietet bei der Ausbildung in Logotherapie und Existenzanalyse Lehrgänge für Lebensberatung und Sozialberatung und Imagination in Verbindung mit...
logotherapie-salzburg.at/
190 DDr. Gerlinde Tscharre Fachärztin Für at
9020
Klagenfurt
ddr-tscharre.at
191 DDr. Gerlinde Tscharre Fachärztin Für at
9020
Klagenfurt
ddr-tscharre.at
192 Dr. med. Natalie Reytan Hautarztpraxis at
10117
Berlin
Die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte bietet eine umfassende Bandbreite der generellen, operativen und ästhetischen Dermatologie...
hautarztpraxisberlin.de – Kosmetik Reytan Hautarztpraxis Dr Private Mitte Berlin Therapie Medizinische Akne Allgemein Kindern Hautarzt Hydrafacial™ Haare Fruchtsäure Teenie
193 empower-coaching Coaching ch
2502
Biel/Bienne
empower-coaching: loslassen, entspannen, Kraft schöpfen, einen Weg finden, sich vorbereiten Empower-coaching soll Ihnen helfen, mit einem akut erlebten oder bevorstehenden Ereignis...
empower-coaching.ch Kraft Praxis Schöpfen Kale Beratung Empower Coaching Fischer Loslassen Psychologische Energiesys­tem Kine­si­olo­gie Entspannen Psy­cholo­gie Etwas All­t­agein­set­zen Belastendes Mit­tels Peternbspfischer
194 TierTherapeuten LIGA Organisation ch
34320
Söhrewald
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Fachkreise Tiertherapeuten Tierhalterpublikum Therapeut Tierhalter Login Ausbildung Anbieter Mission Buchung Akupunktur Ligaisten Mäzenförderer
195 TierTherapeuten LIGA Organisation at
34320
Söhrewald
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Tiertherapeuten Fachkreise Tierhalterpublikum Login Therapeut Tierhalter Ausbildung Buchung Tiergestützte Anmeldung Mission Anbieter Anette Vision
196 24 Stunden Betreuung in 24 Stunden at
6068
Mils
Wir vom Verein 24h-Assistenz-Pflege-Betreuung - APB möchten Ihnen einen unkomplizierten, zuverlässigen und kompetenten Service für Ihre 24-Stunden-Betreuung und Pflege bieten....
24h-assistenz.at/
197 Foyer de Beaute Kosmetikstudio Kosmetik ch
8800
Thalwil
Gesichtsbehandlungen Akne-Behandlung Anti-Aging-Behandlungen Pigmentflecken-Behandlungen Mikrodermabrasion Microneedling Mesotherapie Hyaluron / Filler Faltenunterspritzung Haarentfernung Laser Permanent Haarentfernung Wachs Maniküre Pediküre Massageanwendungen Tanning Selbstbräunung...
foyerdebeaute.ch Z Y
198 Informatik-Support& Beratung PC-Support & ch
4127
Birsfelden
Preiswert, ausgewiesen, kompetent und effizienter In formatiksupport. Ueber 20 Jahre Erfahrung. Daten sicherung, Datenrettung, Datenmigration, bei Neukauf, Computerhilfe und Computerschulung...
computer-arzt.ch Support Pc Mac Hilfe Informatiksupport Informatik Reparaturen Computer Windows Reparatur Schulung Apple Kompetener Erstellung Qualifizierter
199 Zahnarztpraxis Krebs Zahnarztpraxis ch
42699
Solingen
Der Zahnarzt Ulrich Krebs in Solingen steht seit Jahrzehnten und inzwischen in der 3. Generation, für einen qualifizierten und freudlichen...
zahnsolingen.de Ohligs Zahnarzt Solingen Zahnmedizin Implantologie Uns Leistungen Parodontologie Zahnarztpraxis Krebs Praxis Minimalinvasive Msc Ulrich Neuigkeiten Steht
200 Daniel Fuchs - Hotel Unternehmensberatung ch
8595
Altnau
Dr. Daniel G. Fuchs hat 35 Jahre Erfahrung in der Hotel und Ausbildungsbranche, Luxus und Gruppenhotellerie. Lehraufträge an diversen Universitäten...
danielgfuchs.ch/ Daniel Fuchs Services Pictures Michabout Unternehmensberatung Fotos Experte Hoteltourismus Dienstleistungen Contact Professorconsultant Lernveranstaltungen Business
201 Pfefferspray Store Sicherheit Selbstverteidigung ch
7306
Fläsch
Schweizer Pfefferspray-Versand...
pfefferspray-store.ch Pfefferspray Pfefferpistolen Sabre Store Red Versandkosten Uns Agb Mk Mein Konto Jet Pfeffer Trainingswaffen Kartuschen Angel
202 Limousinen-mieten Limousinenservice ch
5610
Wohlen AG
Stretch-Limousinen und Oldtimer finden Sie bei Kiwis Limousinen ltd. von über 25 Fahrzeugen mit 8 Standorten in der Deutsch-Schweiz vertreten....
stretch.ch Limo Limousinen Gästebuch Mieten Oldtimer Stretch Stretchlimo Limos Royce Rolls Zürich Limousine Basel Ab Luzern Rapperswil Jona Zug
203 Medientraining | Kommunikation Kommunikation ch
5622
Waltenschwil
Training und Coaching Medientraining, Kommunikationstraining, Coaching Auftritt und Präsentation, Moderation von Workshops und Grossgruppen visuelle Kommunikation Ob Flyer, Infografik, Broschüre, Webseite, Jahresbericht...
aebi-allenspach.ch
204 Raum für Bewusstein und Hypnosetherapie -coaching ch
3508
Biglen
Systemische Hypnosetherapie /-Coaching. Hypnosystemisches LLC ® Hypnosetherapie - Schweizer Modell © ...Mental und Autogenes Training, lösungsorientiertem Kurzzeitcoaching uvm. zu einem wirksamen und...
zeitgerecht.ch Found Meditation Xidfound Not Guru Error Z
205 Beratung & Interim Management Unternehmensberatung at
2571
Altenmark an der Triesting
Unternehmensberatung die den Ansprüchen von Lean Management gerecht wird. Durch unser Netzwerk an Spezialisten können wir mehrere Themenkomplexe abdecken und...
eccomp.biz Z Zeitpunkt Aufbaubitte Spteren Wwweccompbizdiese Webprsenz Under Currently Versuchen Einmalthis Constructionpleasebefindet Europe Host
206 Zahnarztpraxis Krebs Zahnarztpraxis at
42699
Solingen
Bereits seit Jahrzehnten bietet die Zahnarztpraxis Ulrich Krebs in Solingen versierte Zahnmedizin und eine richtiggehend vertraute Verbindung zu den Praxisbesuchern....
zahnsolingen.de Zahnarzt Ohligs Solingen Zahnmedizin Implantologie Uns Msc Minimalinvasive Parodontologie Ulrich Krebs Leistungen Praxis Zahnarztpraxis Patient
207 Loogo Umzüge Österreich Umzüge at
5400
Hallein
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
208 RZA Business Software IT at
3872
Amaliendorf
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung....
rza.at/
209 RZA Business Software Software at
3872
Amaliendorf
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
rza.at/
210 RZA Business Software Software at
3872
Amaliendorf
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
rza.at/
211 Chiptuning Softwaretuning Kfz at
9500
Villach
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
atr-tuning.eu
212 Chiptuning Softwaretuning Kfz Technik at
9020
Klagenfurt
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
atr-tuning.at
213 Chiptuning Softwaretuning Kfz Technik at
9020
Klagenfurt
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
atr-tuning.at
214 Chiptuning Softwaretuning Kfz at
9500
Villach
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
atr-tuning.eu
215 Chiptuning Softwaretuning Kfz at
9500
Villach
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
atr-tuning.eu
216 Craniosacrale Körperarbeit silent touch Energetiker at
6800
Feldkirch
Praxis für Cranio-Sacrale Körperarbeit, silent touch, Aromalogie, Aromapflege, Arbeit mit dem morphogenetischen Feld Spezielle Angebote für Mutter und Kind, Säuglinge und...
gleichgewicht.jetzt Körperarbeit Grundsätze Gabriele Seitenanfang Craniosacrale Schelling System Finden Inhaltsverzeichnis Tiere Anwendungsgebiete Login Webtemplatedesign Mich Nächste Torsten Körper
217 Gebrauchte Stahlrohre von Ø219mm Handel Gebrauchte lu
50148
Wrocław (Breslau)
Sehr geehrten Damen und Herren, wir bieten Ihnen die gebrauchten geschweißte Stahlrohre. Unser...
shimex.pl Z Y
218 VESPIX Wespen Notdienst KÄRNTEN Schädlingsbekämpfung at
9061
Klagenfurt
VESPIX Wespen und Hornissen Notdienst in Kärnten!...
vespix.at Vespix Valid Wespen Klagenfurt Umsiedelungen Steinacher Wölfnitz Hornissen Preise Inhaber Kärnten Insektenbefall Wespenbekämpfung Stefan Xhtml Föhrengasse
219 Zehrer Bäckereibedarf at
9020
Klagenfurt
Auf Zehrer finden Sie alles zum Backen: Backformen, Rollfondant, Massa Ticino, Ausstechformen, Hohlkörper, Hohlkugeln sowie Kuvertüre. Aber auch zur Tortendekoration...
zehrer.at
220 Kundalini Yoga - Gong Yoga - ch
8840
Einsiedeln
Der Amrit Yoga Verein fördert die Verbreitung von Kundalini Yoga, Karam Kriya (angewandte Numerologie), Yoga Coacing und Gong. Er organisiert...
amrityoga.ch/
221 Lampen und Kronleuchter Beleuchtung ch
5462
Siglistorf
Unser stetig wachsendes Angebot an schönen und hochwertigen Lampen aller Art garantiert Ihnen, dass Sie die für Sie passende Lampe...
traumlampen.ch Versand Kronleuchter Lampen Schweiz Lampe Swarovski Uns Agb Bleikristall Leuchtmittel Shabby Chic Finden Leuchter Kristall Stehlampen Deckenlampen Uhr
222 Gastrogeräte Küchengeräte Gastronomiezubehör ch
5462
Siglistorf
Günstige, qualitativ hochwertige Gastronomiegeräte, Küchenmaschinen, Pizzaöfen, Dönergrill, Küchengeräte, Kühltechnik sowie Outdoormöbel für Ihren Imbissbetrieb, Restaurant, Pizzeria, Partyservice, Catering oder Hotel....
gastrogeraete24.ch/ Versand Geht Unseren Pizzaöfen Finden Weinkühlschränke Uns Pizzaofen Teigknetmaschinen Beheizten Agb Gastronomiegeräte – Weinklimaschränke Vieles Hähnchengrill Zitruspressen
223 Gesamtprogramm für die Ophthalmologie Medizinaltechnik ch
9325
Roggwil TG
Schweizer Gesamtanbieter ophthalmologischer, chirurgischer und diagnostischer Produkte für Augenärzte (Ophthalmologie), Optometristen und Augenoptiker....
mediconsult.ch/de Mediconsult Retina Glaukom Oct Erfahren Katarakt Diagnose Refraktion Ophthalmologie Hospital Anfahrt Vivinex Cornea Chirurgie Adresse Iol Kalkulation Ss Gesamtanbieter Refraktiv Plus Vitrektomie Scan
224 Yoga Aarau und Lenzburg Yoga Aarau und Lenzburg Yoga ch
50005600
Aarau / Lenzburg
Chantal Yoga bietet Yoga Kurse in Aarau und Lenzburg sowie SUP (Stand Up Paddling) Yoga auf dem Hallwilersee und anderweitigen...
chantalyoga.ch Yoga Aarau Lenzburg Flow Chantal Hallwilersee Vinyasa Erfahren Sup Mama Zeit Baby Teacher Training Schwangerschaftsyoga
225 Immobilien Florida Immobilienmakler Florida at
34102
Naples
Haus kaufen Florida – Immobilien Naples, Bonita Springs, Marco, Ft Myers Beach, Sanibel, Cape Coral Suchmaschine für Immobilien Florida, aktuelle Angebote...
immobilienmakler-in-florida.com Florida Naples Immobilien Cape Coral Estero Sanibel Bonita Springs Marco Beach Myers Kirsten Island Fort
226 Pocketmania Online Marketing at
29358
Eicklingen
Ein Vergleichsportal für Pocket Bikes; Monetarisierung durch Affiliate Links...
pocketmania.de/ Pocket Bike Bikes Cross Dirtbike Renn Einzelheiten Amazon Preis Sieger Ebay Elektro ★ Prüfen Versandkosten Takt Max
227 Wagner Umzüge AG Umzugsfirmen ch
4127
Birsfelden
Wagner ist ein bekanntes Umzugsunternehmen im Raum Basel. Seit über 80 Jahren bietet das Unternehmen seine Dienste bereits an und...
wagner-movers.ch Gt Wagner Basel übersee Privatkunden Info@wagner Moversch Geschäftskunden Umzugsfirma Uns International Umzug Umzüge Geschichte Versicherung
228 Angela Hiltbrand Partnervermittlung ch
4001
Basel
Angela Hiltbrand ist eine Partnervermittlungsagentur mit Büros in Basel, Luzern, Bern und Zürich. Mit Fingerspitzengefühl und gesundem Menschenverstand werden Menschen...
angela-hiltbrand.ch Error Errordocumentpermanently Theadditionally Moved Server Internal
229 M.A.N.D.U. Bad Ischl Fitness at
4820
Bad Ischl
M.A.N.D.U. bietet individuelles Personal-Coaching, Kleiner Aufwand, großer Nutzen: Gestärkt und vital in den Alltag mit M.A.N.D.U. Your Lifestyleworkout! Kleiner Aufwand, großer...
mandu.at/standorte/bad-ischl Mandu Bad Ischl Standorte Upgradeeffizientes Browser Team Chrome Tauchen Ansprechpartnerin Petra Activate Ort
230 Redaktor-Online.de Dienstleistungen ch
10715
Berlin
Texte schreiben lassen Mehrere Personen brauchen eine kompetente Texte Schreiben Hilfe. Grundsätzlich verwundert das nicht. Vergessen wir jedoch nicht, dass...
redaktor-online.de Schreiben Kunden Redakteur Arbeit Hilfe Note Befriedigung Zufriedenheitsgrad Redakteure Bestellung Arbeit Bestellungen Bewerbung Aufträge Auträge Abgebrochenbestellungen Arbeitbestellungen Muster
231 Zahnarzt Zentrum fuer Hannover Zahnmedizin ch
30851
Langenhagen
Freuen Sie sich auf Ihren Aufenthalt in der freundlichen Praxisgemeinschaft des Zahnarzt Zentrum Hannover, die Sie im Herzen von Langenhagen...
zahnarzt-zentrum-hannover.de Rarr Zahnarzt Hannover Implantologie Zurück Zentrum Uns Zähne Termin Beratung Langenhagen Tag Patienteninformation Zahnseide Zahlt Leistungen
232 E+B Elektromaqschinen+Beratung A. Meyer Meyer Andreas ch
5600
Lenzburg
- Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschliesslich Retrofit. - Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung...
eund b.ch
233 E+B Elektromaqschinen+ Beratung A. Antriebstechnik Elektrisch ch
5600
Lenzburg
•Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschließlich Retrofit. • Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung und...
eundb.ch Entwicklung Elektromaschinenbau Drehzahlen Forschung Beratung Antriebe Werkzeugmaschinen Motorelemente Berechnung Spindel Hohe + Elektromaschinendienstleistung
234 Zahnarzt Zentrum fuer Hannover Zahnmedizin at
30851
Langenhagen
Für eine extensive zahnmedizinische Versorgung in Langenhagen steht Patienten die Praxisgemeinschaft des Zahnarzt Zentrum Hannover zur Verfügung. Die Praxis hat...
zahnarzt-zentrum-hannover.de Rarr Hannover Zahnarzt Uns Zurück Implantologie Zentrum Beratung Termin Zähne Langenhagen Angstpatienten Hand Scrollen Schienentherapie Wurzelbehandlung
235 Autohaus Moritz fuer Honda Autohaus ch
30880
Laatzen
Erleben Sie kompetente Kundenbetreuung und Verlässlichkeit im Autohaus Moritz, das bereits seit mehr als 40 Jahren einen netten und fairen...
autohaus-moritz.de Honda Hannover Autohaus Hyundai Springe Moritzde Info@autohaus Moritz Gebrauchtfahrzeuge Laatzen Neuwagen Zurück Ihrem Großes Unser Fahrzeuge Fahrzeug
236 Autohaus Moritz fuer Honda Autohaus at
30880
Hannover Laatzen
Das Autohaus Moritz steht seit mehr als 40 Jahren für nette, seriöse Kundenberatung, Sachkenntnis und Zuverlässigkeit unter dem Leitspruch...
autohaus-moritz.de Hannover Honda Autohaus Springe Hyundai Info@autohaus Moritzde Moritz Laatzen Gebrauchtfahrzeuge Unser Marketing Lackiererei Erlebnis
 Frühlingsfest Hauptuntersuchung
237 Elektronische und elektromechanische Antriebe Antriebstechnik ch
5600
Lenzburg
Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschließlich Retrofit. Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung und...
eundb.ch
238 elektronische und elektromechanische Antriebe Elektrische Antriebstechnik ch
5600
Lenzburg
- Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschliesslich Retrofit. - Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung...
eundb.ch
239 Hutter & Sohn - Installateur 24h at
6274
Aschau im Zillertal
Wir sind Ihr verlässlicher Partner in Sachen Rohrbrüche, Verstopfungen und Wasserschäden, zudem bieten wir einen hauseigenen Service für Versicherungen! Unser Komplettpaket...
hutter-sohn.at Notdienst Rohrbruch Leistungen Service Ihr Uns Schimmelpilz Untersuchung Sohn Unser Kanalreinigung Downloads Versicherungen Verstopfung Privatkunden Profi
240 Lampen & Leuchten Großhandel Handel ch
10178
Berlin
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle aus verschiedenen Materialien...
maytoni.de Wholesale Chandeliers Crystal Lighting Modern Europe Street Classic Maytoni Manufacturer Loft Name Catalogue Diamant German Contact Login Invitation
241 Nicole Crestin Zahnarzt ch
2300
La Chaux-de-Fonds
Mit über 30 Jahren Erfahrung bietet die SSO-Zahnärztin Nicole Crestin neben dem SBB-Bahnhof in La Chaux-de-Fonds im Kanton Neuenburg (Neuchâtel)...
ladentiste.ch
242 Naturheilpraktikerin WAM Naturheilkunde - ch
6221
Rickenbach LU
Meine Therapie-Schwerpunkte: • Blutegeltherapie • Orthomolekulare Medizin (Therapeutisch eingesetzte Mikronährstoffe) • Phytotherapie • Ernährungsberatung (Dr. Coy - Anti-Krebs-Ernährung; metabolic balance, etc.) Das dürfen Sie in meiner Praxis erwarten: • Fachkompetenz: langjährige...
naturheilpraxis1a.ch Blutegeltherapie Diagnostik Angebot Therapie Behandlungspläne Krankenkassen Naturheilpraxisa Preise Presse Naturheilkunde Praxis Rickenbach Geering Dipl Naturheilpraxisach Zuber News
243 Tourismusverband Region Hall-Wattens Tourismusverband at
6060
Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und...
hall-wattens.at/ Hall Region Swarovski Haller Winter Urlaub Geschichte Tirol Wattens Sommer Unterkünfte Wandern Essen Nordic Sehenswürdigkeiten Incentive Angebote Kulinarik Sport Events Filmteams Klumperspaß Wellness
244 Heiler und Heilpraktiker für Gesundheit ch
40479
Düsseldorf
Heiler / Naturheiler Werner Münch ist ein besonderer Mensch mit einem außergewöhnlichen Lebenslauf. Er arbeitet viele Jahre als Realschullehrer, bis...
manualmedizin.de Heiler Naturheiler Münch Manuale Werner Kraft Medizin Jahre Bücher Therapie Patienten Wordpress Selbstheilungskräfte Mensch Seele Mich Skeptiker
245 Graphologie Dienstleistungen Personalberatung ch
8800
Thalwil
Graphologie und Handwriting-Assessments®, die einfache und umfassende Lösung zur Einschätzung einer Persönlichkeit. Hier finden Sie allgemeine Informationen über die Graphologie...
grapho.ch Graphologie Handwriting Homepage Informationen Assessment Zurück Uumlber Gtltbr Angebot Auftrag Anliegen Hauptmenü Kandidat Angeboten Finden Gtauf Laufbahn Website Personalentwicklung Handschriftendeutung Spycher
246 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
6072
Sachseln
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
hochzeitsfotograf-zentralschweiz.ch
247 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
6072
Sachseln
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
hochzeitsfotograf-zentralschweiz.ch
248 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
6072
Sachseln
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
hochzeitsfotograf-zentralschweiz.ch
249 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
6072
Sachseln
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
hochzeitsfotograf-zentralschweiz.ch
250 Gasthof Hotel Grünauerhof Tourismus at
5071
Wals bei Salzburg
Gasthof und Hotel Grünauerhof in Wals bei Salzburg - Ihr Seminarhotel mit eigenem Restaurant im Salzburger Land. Die Unterkunft ist...
gruenauerhof.com/ Hotel Restaurant Wals Salzburg
251 Torostone GmbH Geschenke Gravuren ch
9000
St. Gallen
Torostone GmbH ist ein innovatives Handels- und Produktionsunternehmen mit Hauptsitz in St. Gallen und einem Büro mit Produktion in Sirnach...
torostone.ch/ Geschenke Stempel Gravuren Torostone Partner Hauptsitz Thurgau Niederlassung Gallen St Sirnach Ihrz
252 Schwerthaus Wald ZH Restaurants ch
8636
Wald
Die italienische Küche ist weltberühmt - und das nicht nur für ein Gericht, wie es bei vielen anderen Nationen der...
schwerthaus.ch Pesci Menükarte Kinderkarte Pasta Carni Event Dessert Pizze Reservierung Schwerthaustischreservierung | Galerie Anfahrt Z
253 Alpha Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch/
254 Alpha Gravuren Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch/
255 Alpha Gravuren Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch/
256 Alpha Gravuren Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch
257 Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch
258 Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch
259 Gravuren Gravuren und ch
8952
Schlieren
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
alphagravur.ch
260 Dr. med. Natalie Reytan Gesundheit ch
10117
Berlin
In der Mitte Berlins kann eine breit gefächerte Palette der allgemeinen, operativen und ästhetischen Dermatologie bei der privaten Praxis für...
hautarztpraxisberlin.de – Hautarztpraxis Kosmetik Kindern Akne Allgemein Therapie Hautcheck Hydrafacial™ Glykolpeeling Reytan Berlin Fruchtsäure Md Uns Med Unserer Fotodokumentation
261 VISUELLE FABRIK – Corporate Grafik Design ch
4052
Basel
Komplettlösungen im visuellen Bereich – Grafik Design aus Basel (Schweiz) – Visuelle Fabrik: Grafik Design, Corporate Design, Webdesign, Visuelle Kommunikation...
visuellefabrik.ch Design Visuelle – Portfolio Fabrik Corporate Dienstleistungen Communication Visuellen Grafik Roman Pinterestbasel Komplettlösungen
262 Biogena Mikronährstoffe und Nahrungsergänzung Nahrungsergänzungsmittel at
5020
Salzburg
Vitamine, Mineralstoffe und Spurenelemente abdecken: Biogena ist österreichischer Hersteller von Nahrungsergänzungsmitteln sowie Mikronährstoffpräparaten und auch vegetarische und vegane Kapseln ohne...
biogena.com/
263 Biogena Mikronährstoffe und Nahrungsergänzung Nahrungsergänzungsmittel at
5020
Salzburg
Vitamine, Mineralstoffe und Spurenelemente abdecken: Biogena ist österreichischer Hersteller von Nahrungsergänzungsmitteln sowie Mikronährstoffpräparaten und auch vegetarische und vegane Kapseln ohne...
biogena.com/
264 Psychotherapie Luzern Psychotherapie ch
6003
Luzern
Suchen Sie Hilfe: Daniel Kaeser, eidg. dipl. Fachpsychologe für Psychotherapie bietet Ihnen Psychotherapie in Luzern an. Psychotherapie ist eine besondere Art...
luzerner-psychotherapie.ch Psychotherapie Daniel Luzern Kaeser Psychotherapeut Coaching Luzerner Psychologe Sbap Praxis Therapie – Meine Paartherapie Kosten Telefon Eidg Zsbbern
265 LOCAL Restaurant Bäckerei ch
5600
Lenzburg
Local befindet sich in nächster Nähe zum Bahnhof mitten in der Stadt Lenzburg. Ein einmaliges kulinarisches Erlebnis zum Verweilen und...
local-group.ch Local Group Wohlen Offene Lenzburg Stellen Front Mitarbeiter Hotels Seengen Info@local Groupch Schutz Show Unterdorfstrasse Ch } {locationname Erlebnis Apartments
266 White Collar Massmode Massmode Massbekleidung ch
4051
Basel
White Collar Massmode ist Ihr Spezialist für individuelle Massmode und Massbekleidung. Wir fertigen Ihren persönlichen, auf Ihre Masse zugeschnittenen Massanzug...
whitecollar.ch Accessoires Schweiz Krawatten Manschettenknöpfe Einstecktücher Mass White Anzug Massmode Collar Whitecollarch Anzugshose Tuxedo Massgeschneiderte Krawattenhalter Masshemd Massanzug Apache
267 Gesundheitsmassage Massage ch
9555
Tobel
In der heutigen Zeit wo Stress und Hektik vorherrschen, ist es für viele von uns immer schwieriger geworden, Zeit und...
corinnesmassagerueuemli.ch Massagerüümli Massage Ausbildung Methode Preise Mich Dorn Powerstrips Gutschein Fgxpress Gästebuch Geschenk Reset Shop öffnungszeiten Auszeit
268 Ihre Homepage von Profis Werbeagentur und at
5020
Salzburg
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
salzburg.software Webshop  » Domain Informationen Hosting Marketing Beratung Firma Support Produkte Cloud Homepageblog Menü
269 Ihre Homepage von Profis Werbeagentur und at
5020
Salzburg
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
salzburg.software
270 Ihre Homepage von Profis Werbeagentur und at
5020
Salzburg
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
salzburg.software
271 Mediations-Supervision Mediation ch
8492
Wila
Supervision dient der Reflexion des beruflichen Handelns und versteht sich zudem als Beratungs- und Weiterbildungsangebot. Im Zentrum steht die Verbesserung...
fredhaslimann.ch Z Y
272 AUTO-KOHL Autowerkstatt und Abschleppdienst Autowerkstatt Abschleppdienst at
91056
Erlangen
Seit 1991 bietet die Firma Auto Kohl GmbH einen Komplettservice rund ums Fahrzeug: Abschleppdienst und Pannenhilfe im Auftrag des ADAC...
autokohl.de Abschleppdienst Auto Kohl Erfahren Erlangen Adac Reifenservice Unfallinstandsetzung Pannenservice Huau Instandhaltungsarbeiten Inspektionen Verschleißreparaturen ✔ Klima Pannenhilfe
273 Ansteck-Buttons für jeden Anlass Grafik Werbung ch
6103
Schwarzenberg LU
Mit Ansteck-Buttons werben Sie effizienter für Ihre Firma als mit einem Inserat - Garantiert! Denn Buttons sind günstiger und erreichen...
buttonz.ch Z Y
274 Tanja Obersteiner Bowen - at
9500
Villach
tanjaobersteiner.at   Bowen Technik Termin Wen Anwendungsgebiete Michtanjaobersteiners Webseite  die Originale
275 Autolampen & Autobatterien Autolampen & Autobatterien Autozubehör Autobeleuchtung ch
8280
Kreuzlingen
Als Schweizer online Grosshändler bieten wir auf carspoint.ch ein weites Portfolio an sofort verfügbaren Xenonbrennern, Halogenlampen, LED Leuchtmitteln und Glassockellampen...
carspoint.ch Ds Ww Hb Pw Leuchtmittel Dr Wyw Xenon Led Autobatterie Prw Rw Tw Cw Pyw Road Hyw
276 Software Xpandit Xpandit mobile Softwareentwicklung und ch
5040
Schöftland
Seit mehr als 30 Jahren entwickelt und bietet Braso AG Software für Elektrounternehmen, Schaltanlagen- und Steuerungsbauer, HLKS-Unternehmen, Dienstleistungen, den Buchhandel...
braso.ch Xpandit Braso Hlks Software Planung Auftragsbearbeitung News Buchhaltung Support Projektkontrolle Mobile Kursdaten Lösungen Branchen Mitarbeiter Betriebe Cockpit
277 Heliotherm Wärmepumpentechnik Ges.m.bH Wärmepumpenhersteller at
6336
Langkampfen
Heliotherm produziert Wärmepumpen zum Heizen, Kühlen und zur Warmwasserbereitung. Das Produktspektrum umfasst: - Erdwärmepumpen mit Flachkollektor - Natural Technology Wärmepumpen - Solewärmepumpe - Luftwärmepumpen in...
heliotherm.com Wärmepumpen Wärmepumpe Heliotherm Erdwärmepumpe Luftwärmepumpe Entscheiden Weg Unabhängigkeit Partner Energien Videos Newsarchiv English Ob Lexikon Flachkollektor Luft
278 Akupunktur Yin Yang Medi Akupunktur ch
3052
Zollikofen
yinyangmedi.ch/tcm-zentrum-zollikofen Zollikofen Akupunktur Schröpfen Massage Therapie Yin Yang Schmerzen Stadt Behandelt Psychefrauenleiden Haut Tarife
279 LAN-Thermometer für Temperaturüberwachung Hersteller LAN-Thermometer at
48163
Münster (DEUTSCHLAND)
http://www.lan-thermometer.de/ präsentiert: LAN-Thermometer für das präzise Temperatur Monitoring über Netzwerk oder Internet der Herstellermarke Didactum Mit dem LAN-Thermometer von Didactum kann die...
lan-thermometer.de Didactum Thermometer Lan Temperatur Monitoring Snmp Temperatursensor Temperaturüberwachung Sensoren Raumtemperatur Systems Security Thermometers Software Sms* Messen Google+ Kritischeereignisse Verfügbarkeit
280 LAN Thermometer von Didactum Hersteller LAN lu
48163
Münster Deutschland
http://www.lan-thermometer.de/ präsentiert: LAN Thermometer für die Temperaturerfassung über TCP/IP Netzwerk des Herstellers Didactum Mit dem LAN-Thermometer des Herstellers Didactum kann die Temperatur...
lan-thermometer.de Didactum Thermometer Lan Temperatur Monitoring Raumtemperatur Temperaturüberwachung Snmp Sensoren Temperatursensor Security Systems Thermometers Sms* Lager Serverraumverursachter Temperaturnachweis Dateien Itangewiesen
281 SolidWorks Schulung Bildung ch
83620
Feldkirchen Westerham
Erstellen Sie mit SolidWorks parametrische Zeichnungen wie ein Profi SolidWorks ist eine Software, die Ihnen zur Verfügung steht um Modelle und...
solidworks-schulung.de/kurse/ Solidworks Draftsight Video Tutorial Cad Schulungen Interconnect Pdm Abrunden Consulting Videotutorial | Linienskalierung Verbesserungsvorschläge Simulation Spalten“ Schulung
282 Institut für Gesundheit Gesundheit ch
8117
Fällanden
Endermologie, LPG, Vitalfeldtherapie, Global Diagnostic, Ernährungsberatung, Nahrungsergänzungsmittel, Power Plate, Sanguinum, Stoffwechselkur, Entgiftung, Haaranalysen, Vitalstoffberatung, Ultraschall-Kavitation, Traditionelle Chinesische Medizin...
medshape.ch Medshape Shopabnehmen Medizin Betreute Institut Gesundheit Gesund Stoffwechselkur ästhetische Nachhaltigihrem Angebot Medizinisch
283 Günstige Zirbenspäne für Zirbenkissen Holzdekoration at
8931
Kirchenlandl
Zirbenflocken und Zirbenhackgut Luftgetrocknet, frisch gehobelt und gesiebt aus Österreich. All Inclusive Versand! Intensiver Zirbenholz Duft und Wirkung!...
zirbenspaene.at Wirkung Zirbe Zahlungsbedingungen Nachfüllen Zirbenkissen Intensiver Liefer Gehobelt Günstige Luftgetrocknetzirbenspäne Zirbenhackgut Duft Gesiebt
284 Beamerlampen Projektorlampen Beamerlampen Projektorlampen Elektronikgrosshandel ch
8280
Kreuzlingen
Wir bieten Ihnen ein Komplettsortiment von Projektorlampen aller Projektorhersteller. Zusätzlich zu unserem Angebot von über 1500 Beamerbirnen für mehr als...
beamerlampe24.ch Beamerlampen Beamer Projektoren Kaufen Ersatzlampe Beamerlampe Zahlungsmöglichkeiten Kompatibleregistrieren Neu Marke Befinden Warenkorb Originalherstellerlampen
285 Praxis für Physiotherapie Christian Physiotherapie - at
4020
Linz
Jeder Mensch ist anders. Jeder Körper ist anders. Jede Therapie ist anders! Daher steht am Anfang der Therapie ein ausführliches Gespräch...
physio-sobl.at Physiotherapie Therapie Meine Meilensteine Anfahrt Training Tarife Leistungen Massage Praxis Anders Linz Zielenentsprechen Mensch ist Rückenschmerzen
286 Nummernschildhalter Edelstahl Fahrzeugzubehör ch
6103
Schwarzenberg LU
Die ZENURA (Zemp`s-Nummern-Rahmen) für Nummernschilder sind aus massivem Edelstahl gefertigt und werden seit 2007 in bester Qualität gefertigt. Egal ob Sie...
zenura-nummernrahmen.ch Z Y
287 Trigonorm - Regalsysteme und Lagerung ch
3673
Linden
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
trigo.ch
288 Trigonorm - Regalsysteme und Lagerung ch
3673
Linden
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
trigo.ch
289 Trigonorm - Regalsysteme und Lagerung ch
3673
Linden
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
trigo.ch
290 Fensterkitt Computer Support PC Support ch
2500
Biel/Bienne
Der professionelle PC Support in der Region Biel Seeland. Seit 2003 lösen wir Computer Probleme unserer treuen Kundschaft. Egal ob...
fensterkitt.ch Support Version Windows Computer Linux Fensterkitt Viren Canonical Seeland Hilfe Microsoft Pc Services Jahren Betriebssystem Scammer Bot Armee
291 Top Pools Kärnten und Pool Schwimmbad at
9063
Maria Saal
Polypropylenpool, Folienpool, Schwimmteich, Naturpool, Pool-Überdachung, Planung, Beratung und Pool-Bau! Ihr Poolspezialist für Kärnten und Steiermark!...
toppools.at Wasseraufbereitung Technik Pools Naturpools Folienbecken Kärnten Chlor Toppools Ozon Admin Posted Reinigung Polypropylen Poolüberdachung Investition Poolbedarf Einbauteilentechnik
292 Familienstellen Systemisches Stellen Persönlichkeitsentwicklung Coaching ch
8352
Elsau
Claudia Honegger, Systemische Lösungen, Familienstellen, Systemisches Stellen, Einzel- und Gruppenaufstellungen in Elsau, Winterthur, Matrix, Achtung - Lösung - Los, Symptome...
lichtpunkt-leben.ch
293 IT Lösungen EDV ch
4133
Pratteln
Flexible und schnelle Lösungen. Damit Sie Ihre Zeit nicht dafür aufwenden müssen IT-Probleme zu lösen, Prozesse zu optimieren und Ihr...
itservices-kmu.ch/ Support Server Netzwerk Blog Informationen Produkte Dienstleistung Menü Archiv Services Helpdesk Hilfe Digital Starken Servicehilfe Telefon Verlassen Bieten
294 BKOS GMBH Bau ch
8640
Rapperswil
BKOS GMBH ist spezialisiert auf Betonkosmetik, Graffitischutz, Oberflächenschutz und Spezialreinigungen. Dabei stehen insbesondere Naturstein und Sichtbetonflächen im Fokus. Wir haben...
bkos.ch Betonkosmetik Graffitischutz Jobs Zh * Dienstleistungen Betonreinigung Betonschutz Passwort Jona Naturstein Bkos Stäfa Benutzername Sg * Uns Ihreoberfläche Serviceleistungbei Homebauten Algenschutz
295 Hypnose Zentrum Köln Gesundheit ch
50668
Köln
Das Hypnose Zentrum Köln, ganz mitten im Zentrum der Metropol-Region Köln, Düsseldorf und Bonn hat sich darauf spezialisiert seine Klienten...
hypnose-zentrum-koeln.de Hypnose Köln Erfahren Angeboten Abnehmen Selbsthypnose Rauchen Selbstvertrauen Coaching Ausbildung Selbstbewusstsein Zentrum Dank Selbstbewusster Raucherentwöhnung
296 Übersetzungen Korrekturen und Lektorate Dienstleistung ch
9015
St. Gallen
Wir empfehlen uns für Übersetzungen, Korrekturen und Lektorate in jeder Fachrichtung und jeder gängigen Weltsprache. Dank einem grossen Netz an...
wettstein-uebersetzungen.ch Wettstein Lektorate übersetzungen Korrekturen Contact Kompetent Mitarbeiter Gericht Uebersetzungen Konsulat Schnell Beglaubigungen Dienstleistungen Weltsprachen Anerkannt Gerne Auch Unternehmensbroschüre
297 LAN Thermometer vom Hersteller Hersteller at
48163
Muenster Deutschland
http://www.lan-thermometer.de präsentiert: LAN-Thermometer für die Messung und Überwachung der Temperatur in wichtigen Räumen. Didactum, Hersteller von IT Überwachungssystemen, hat mit dem...
lan-thermometer.de/ Didactum Thermometer Lan Temperatur Monitoring Sensoren Snmp Temperatursensor Temperaturüberwachung Raumtemperatur Security Thermometers Systems Netzwerk Temperaturaufzeichnung Klimaanlage Unternehmenlahmlegen Räumen Temperaturprotokoll
298 Praxis für Psychotherapie und Psychotherapie at
4020
Linz
Psychotherapeutische Krankenbehandlung und Gesundheitserhaltung. Psychotherapie in Linz. Burnout, Depressionen, Ängste, Krisen, etc....
rme.or.at Psychotherapie Training Beratung Coaching Punkt Mayer Exner Praxis Team Ziele Wahrnehmung Biografie Männer Perspektiven Platz Tiefenpsychologische
299 3 Stück Chefsessel Büromöbel at
8933
St.Gallen
Verkaufe 3 Stück Büro-Drehstühle ( auch einzel ). Marke : Röder 1x Lehnenhöhe 80cm, 2x Lehnenhöhe 60cm; Sitzbreite, Sitztiefe 50cm; 5 Rollen...
300 Fluorfreie Imprägnierung Imprägnierung ch
9403
Goldach
IMPREGNO ist ein PFC-freies Hydrophobiermittel zur Langzeitimprägnierung für die Anwendung auf Textilien, insbesondere für Outdoor-Artikel, Stein, Holz, Leder oder Kunststoff. IMPREGNO-Imprägnierung...
impregno.ch Impregno Imprägniermittel Shop Imprägnieren Schuhe Imprägnierspray Imprägnierung Oberflächen Datenschutzbelehrung Holz Wash Fragen Mail@impregnoch Direkt Zusatz

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Les

+ Kommentar oder Kleinanzeige für Les eintragen!

301 Accueil :: Carrosserie InterMarques carrosserie
1994
Aproz-Nendaz
Carrosserie InterMarques SA à Aproz Nendaz Sion (Valais) exécute réparations tôlerie travaux ... constat d'accident à l'amiable . Assistance en cas d'accident nous vous déchargeons de toutes les
carrosserie-intermarques.ch Carrosserie Intermarques Toute Marque
302 Page d'accueil
1991
Salins
... environnement pendant des dizaines d'annà es pour satisfaire les appà tits financiers d'une petite poignà e de
sauvegardonscoteau.ch
303 Axecib Formation Accueil
1996
Saclentse
... notre site les dates de nos prochains cours FFA en et avec de nouvelles dates et de nouveaux
axecib.ch
304 Lud'Oasis ludothèque de Nendaz ludothèque
1996
Basse-Nendaz
Lud'Oasis ludothèque de Nendaz. Nous nous réjouissons de vous accueillir dans nos locaux et ... Pas encore d'idées pour vos cadeaux de Noël ? Venez tester les jeux à la ludothèque ! Plus que
ludonendaz.ch Ludothèque Nendaz Lud'oasis Oasis
305 Fusaiole.ch atelier tissage metiers fusaiole
1991
Salins
FUSAIOLE.CH – atelier de tissage membre des metiers d'art du valais. Artisan indépendant. Reçois ... . Février création axianet Copyright - La Fusaïole - Tissage - CH Salins Téléphone
fusaiole.ch Fusaiole Fuseau Atelier Tissage
306 Die Webagentur für Webdesign Magento
1996
stehen wir für fachgerechtes WebWerk ein.
Ihre Webagentur mit 16 Jahren Erfahrung für bestes Webdesign Content Management ShopLösungen ... in bis Wochen - kein Problem. Lesen Sie mehr... Zukunftsgerichtet Multimedia und D Seit
webvision.ch Magento Commerce ShopLösungen CMS Webagentur
307 Accueil machines
1996
Basse-Nendaz
Garage de la Printse à Nendaz véhicules et machines agricoles quads motoneiges ... votre disposition en location. Voir la page locations . Contact Route de Fey CH- Basse-Nendaz
garagedelaprintse.ch Machines Agricoles Tronçonneuses Stihl Quads
308 Accueil Le Jardin
1991
Salins
Institut "Le Jardin des Sens" à Salins. Massages divers : relaxant sportif du ... essentielles.? Massages pratiqués avec Respect et Joie Soins remboursés par les caisses maladies (assurance
lejardindessens.ch
309 Lathion frères menuiserie Menuiserie
1997
Haute-Nendaz
Lathion frères menuiserie agencement ébénisterie 1997 HauteNendaz
lathion-freres.ch Menuiserie ébénisterie Lathion Frères
310 Bienvenue: l'Ecole Suisse de nendaz
1997
Haute-Nendaz
Depuis plus de 50 ans l'école suisse de ski Nendaz propose toute sorte de cours ... - Vidéos? Infos parents - FAQ? Repas - Prise en charge? Bons cadeaux? Les tarifs - Brochure? Nos
ecoledeskinendaz.ch Nendaz Ski Cours Lesson
311 Nordic Made plaid
1997
Haute-Nendaz
Norwegian Design ... Conseils Contact Professionnel Particulier Accueil Nouvelles couleurs pour les coussins Rutig Strandråg de
nordicmade.ch Plaid Couverture Valais Suisse
312 TransElec Ingénierie Sàrl TransElec
1997
Nendaz
TranElec Ingénierie Sarl spécialiste des lignes de transport nouvelles réalisation inventaire et ... inventaires et démantèlement. Nos prestations comprennent l'acquisition de données les levés laser la
transelec-ing.ch TransElec David Vionnet Ingénierie Lignes
313 Acceuil Hotel
1997
Haute-Nendaz
Hotel Restaurant Edelweiss ... Basse Saison Béneficiez de % de rabais sur la location le logement et les abonnements de ski. Plus
edelweissnendaz.ch Hotel Restaurant Nendaz Ski Bike Apresski Music Musique
314 ESI Arc en Ciel Nendaz
1997
SIVIEZ-NENDAZ
ESI Ecole de ski et école de snowboard pour enfants et adultes située ... ROSABLANCHE CP CH- SIVIEZ-NENDAZ + INFOARCENCIEL-SIVIEZ.CH PLAN DU SITE LISTE DES ESI
arcenciel-siviez.ch Nendaz Ecole Du Ski Français Ecole Suisse De
315 SkiClub Arpettaz Arpettaz
1997
Haute-Nendaz
Site du skiclub Arpettaz de Nendaz ... ski pour les enfants Les cours de ski seront organisés aux dates suivantes Samedi décembre
arpettaz.ch Arpettaz Skiclub Ski Neige
316 Welcome to Second Wind
1997
Haute Nendaz

secondwind.ch
317 Esports
1997
Haute-Nendaz
Esport Sport Shop online
esports.ch
318 Accueil
1997
HAUTE-NENDAZ
tourisme valais conseil ... ... Février Les espaces ruraux d?une économie productive à une économie résidentielle et présentielle
berep.ch
319 Ac crea design ac crea design gmbh HauteNendaz
1997
Haute-Nendaz
ac crea design gmbh HauteNendaz VS
ac-crea-design.ch HauteNendaz TShirt Drucken Sticken
320 Accueil
1997
Haute-Nendaz
... Accueil Page d'accueil Devenez membre Actus Actus Les expos Expo actuelle Archives Programme
nendartistes.ch
321 Home lescanards
1997
Haute-Nendaz
... Home Das Chalet Innen Umgebung Ski-Gebiet Contact Welcome to Les Canards In unserem schönen Chalet
lescanards.ch
322 Brasserie artisanale des SixClos Sixclos
1619
Les Paccots
La brasserie des SixClos est une microbrasserie artisanale Suisse qui brasse ses bières avec de ... Accueil Infos Bières Contact Bienvenue! Microbrasserie artisanale situà e dans les Prà alpes
sixclos.ch Sixclos SixClos Brasserie Microbrasserie
323 Accueil GC
2336
Les Bois
GC Maket entreprise de services architecturale ... Projets Projets Projets Projets Contact Doubs CH- Les Bois Switzerland Fixe
gcmaket.ch GC Maket Villa Construire Franchesmontagne
324 TransSoft Exportlösungen für
1988
Les Collons
Exportdokumente: EDVObligatorium ab 1. Januar 2013
transsoft.ch
325 Talent Management HR Talentware
1227
Les Acacias-Carouge
Best in class Talent Management solution in the Swiss Cloud. Complete. Modular. Powerfull. Affordable ... Implementation Services Support Services Pricing About Us Contact Us Talentware Route des Jeunes Les
talentware.ch Talentware Talent Management Swiss Cloud
326 Chezirene.ch appartement
2722
Les Reussilles
appartement vacances Les Reussilles Tramelan location ... Appartement de vacances à louer Ferienwohnung zu vermieten Les Reussilles Tramelan chambres à coucher
chez-irene.ch Appartement Vacances Les Reussilles Tramelan
327 Le Clos Josenat
2714
Les Genevez

closjosenat.ch
328 Biacryl Webshop Biacryl
2126
Les Verrieres
Biacryl Webshop
biacryl-shop.ch Biacryl Webshop
329 L'Eclipse Maison des eclipse
1220
Les Avanchets
Situé aux Avanchets à côté de Balexert à Genève la maison des jeunes l'eclipse ... des Jeunes l'Eclipse Route de Meyrin CH- Les Avanchets + +(
mjeclipse.ch Eclipse Maison Des Jeunes Mjeclipse Avanchets Balexert Jeunes
330 Dimatech SA | Technologie
2336
Les Bois
... toute une région. Dimatech SA Guillaume-Triponez CH- Les Bois +
dimatech.ch
331 Eléments Terre Construction Sàrl
1833
Les Avants

elements-terre.ch
332 UrsaVibrasons Musik Kreativität
2714
Les Genevez
... -vibrasons Ursula Botteron Clos-Dedos b CH- Les Genevez phone +
ursa-vibrasons.ch
333 CMC Biacryl SA biacryl
2126
Les Verrieres
Biacryl is working with acrylic materials for more than 25 years. For more than 15 ... - ZI de la glaciere - CH - Les Verrieres
biacryl.ch Biacryl Acrylic Acrylglas Acrylique
334 Aquarine Aquarelle
1607
Les Thioleyres
... généreusement ses acquis d'autodidacte. Les techniques enseignées m'ont permis de développer un intérêt
aquarine.ch Aquarelle Catherine Monod Aquarelliste
335 Buvettes d'alpage de Suisse
1619
Les Paccots
Buvettes d'alpage métairies et restaurants d'altitude de Suisse romande ... et manifestations organisées par les buvettes c'est par ici ... Lire la suite Le meilleur du terroir
buvette-alpage.ch
336 Base : bureau base
1873
Les Crosets
Location d'appartements de vacances les Crosetsvalaissuisse Gardiennage et conciergerie Aide de bureau secrétariat ... CP CH - Les Crosets Tel + Portable + Contact
b-a-s-e.ch Base : Bureau Accueil Services
337 LaFaMi Tille Accueil Famille
1660
Les Moulins
Accueil LaFaMi Tille Famille Tille
familletille.ch Famille Tille Terre Et Lune Trio
338 Home Sobatech SA sobatech
2206
Les Geneveys-sur-Coffrane
bietet Stahlschalung Rundschalung Arbeitsbühnen für Sichtbeton in Perfektion. Qualität ... - Verkauf SOBATECH SA - Bellevue - CH- Les Geneveys-sur-Coffrane - + - +
sobatech.ch Sobatech Logistisch äusserst Wandschalung
339 FSG Geneveys et Coffrane Sport
2206
Les Geneveys-sur-Coffrane
... Contact Archives Soirées Home // Bienvenue sur le site de la FSG Les Geneveys Coffrane Notre
fsg-geneveyscoffrane.ch Sport Athlétisme GeneveyssurCoffrane FSG
340 Accueil
1865
Les Diablerets
... système a été créé et le lien vers les réservations sur ce site a été modifiié. Ne soyez donc pas surpris
tcdiablerets.ch
341 Téléski Les Breuleux SA les
2345
Les Breuleux
Société du Téléski Les Breuleux SA ... Téléski Les Breuleux SA Aller au contenu Menu principal Accueil Nos installations Buvette et
telebreuleux.ch Les Breuleux Téléski Téléski Les Breuleux Télébob
342 Les Bois. Grandeur Nature. Les
2336
Les Bois
Commune Les Bois ... du sud/sud-est Cortège de la désalpe du Boéchet Golf-Club Les Bois Passage du train au Boéchet Lac de
lesbois.ch Les Bois Commune Les Bois Rudisylvain
343 Bienvenue aux Lilas Hôtel
1865
Les Diablerets
Hôtel de charme dans un petit chalet au grand confort aux Diablerets dans les ... Hôtel les Lilas Les Diablerets Chambres Réservations Réserver en ligne Prix et Conditions Groupes
les-lilas.ch Hôtel Hébergement Auberge Pension
344 KIKO MOTOS
2208
Les Hauts-Geneveys

kikomotos.ch
345 Hôtel Restaurant De La Hôtel
2722
Les Reussilles
... sommes fermés le mercredi dès h et le jeudi toute la journée. Les autres jours nous vous
laclef.ch Hôtel Restaurant Les Reussilles La
346 Archives et Bibliothèque de archives
2722
Les Reussilles
Archives et Bibliothèque de la Conférence Mennonite Suisse
menno-arch.ch Archives Archiv Mennonites Mennoniten Conférence Konferenz Suisse
347 Mennosonnenberg.ch
2722
Les Reussilles
... jeanguisboden les mottes mont-tramelan tramelan photos liens contact deutsch Bienvenue sur notre site internet A
menno-sonnenberg.ch
348 MaminFidu
2208
Les Hauts-Geneveys
... protégée contre les robots spammeurs. Vous devez activer le JavaScript pour la visualiser. Qui sommes
maminfidu.ch
349 Manège du Vanel manège
2206
Les Geneveys-sur-Coffrane
manège pension et cours d'équitation tous niveaux GeneveyssurCoffrane à 10 minutes de
manegeduvanel.ch Manège équitation Attelage Pension Chevaux
350 Marcus Egli accueil Marcus
2316
Les Ponts-de-Martel
Marcus Egli ne se dit pas sculpteur mais métallier. Il rencontre l'aluminium en 1980
marcusegli.ch Marcus Egli Métallier Homnium Pontsdemartel
351 NJ Diffusion SA         Tél
2345
Les Breuleux
... NJ Diffusion SA Tél. + Chemin des Barres Nat. + Les Breuleux
nicolasjuillerat.ch
352 NLZOUEST
1865
Les Diablerets
Ziel der Nationalen Leistungszentren Mitte (Engelberg) West (Brig) und Ost (Davos) ist es
nlz-ouest.ch
353 Les PerceNeige
2208
Les Hauts-Geneveys
... Les Perce-Neige Domaines de Compétences Ecole Spécialisée Autonomie Large Autonomie Légère
perce-neige.ch
354 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Route Cantonale Les Evouettes Tél. Lundi mardi h-h Mercredi h-h
pda-phone.ch Htc Htc Suisse Samsung Suisse
355 Solutions Development coaching
1619
Les Paccots

sdcoach.ch Coaching Coaching Practice Coaching Program
356 Temet Nosce hypnose
1227
Les Acacias
Centre de formations et thérapies naturelles réalisé autour de médecines alternatives tel que l'hypnose ... Présentation du centre Les thérapeutes Actualités J'ai débuté l'hypnose au mois de février après en avoir
temet-nosce.ch Hypnose Hypnothérapie Hypnotisme Genève
357 Soldev Accueil
2345
Les Breuleux
... SOLDEV SÃ rl Les Seignes TÃ l + CH- Les Breuleux +
soldev.ch
358 Sogecom Bienvenue !
1227
Les Acacias

sogecom.ch
359 Solutions Development coaching
1619
Les Paccots

solutionsdevelopment.ch Coaching Coaching Practice Coaching Program
360 Stéphane Joly Stéphane
2345
Les Breuleux
Stéphane Joly champion suisse de cross
stephanejoly.ch Stéphane Joly Champion Suisse Cross Course à Pied
361 BDD Cie SA
1227
Les Acacias
... Dumont Delaunay Cie SA Route du Grand Lancy A Case postale CH - Genève +
bdd.ch
362 Accueil
2336
Les Bois
... l'entoure. L'essence de cette science holistique se retrouve dans la philosophie taoïste les triades
biopsychologie.ch
363 ControlDesign Home AMX
1080
Les Cullayes
Service indépendant de programmation et d'ingénierie dans les secteurs de la domotique et des systèmes
controldesign.ch AMX Programmation Programmeur Domotique
364 Bienvenue sur Cinéma Lux cinéma
2345
Les Breuleux
cinéma Lux Les Breuleux cinéma et salle de spectacles en location. Votre cinéma ... . Tolkien. LE HOBBIT LA BATAILLE DES CINQ ARMÉES conclut les aventures de Bilbon Sacquet Thorin Écu-de
cinemalux.ch Cinéma Cinema Spectacle Infrastructure Location Loisirs Les Breuleux
365 Cimagine.ch | Bienvenue
2722
Les Reussilles

cimagine.ch
366 Difaco Sàrl: Construction de
1865
Les Diablerets
... de qualité - Rapidité d'exécution Difaco privilégie et utilise les énérgies renouvelables Nos bureaux
difaco.ch
367 Aspirateur central pouissièes et aspirateur
1227
Les Acacias
Drainvac Suisse Sarl Aspirateur Central poussières et liquides. service de dépannage toutes marques. Désinfectez ... Russie ou en Chine. DRAINVAC a à tà reconnu comme les meilleures centrales d’aspirateurs centraux dans
drainvac-suisse.ch Aspirateur Central Aspirateur Poussières Aspirateur Liquides
368 Giordano Peinture
1346
les Bioux
vallee joux:peinture platrerie entreprise
giordano-peinture.ch
369 Garage Natec SA
1346
Les Bioux
...  Garage Natec SA Les Bioux Garage Natec SA Les Bioux Garage Natec SA au Bioux
garagenatec.ch
370 Haldemann Porret SA
2416
Les Brenets
... INFORMATIONS ACCUEIL L'ENTREPRISE Forte de plus de ans d'expérience notre société est spécialisée dans les
hpsa-laser.ch
371 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h-h
htc-pda.ch Htc Htc Suisse Samsung Suisse
372   ACCUEIL Hughes;Richard;La
2316
Les Ponts-de-Martel
Site officiel de Hughes Richard. Originaire de Lamboing il y naît le 12 juillet
hughesrichard.ch Hughes;Richard;Lamboing;Plateau De Diesse;PontsdeMartel;A La Main Amie;poète;In
373 Home des Bayards Home
2127
Les Bayards
Le home des Bayards est une petite institution médicalisé chaleureuse qui apporte de la convivialité ... d'elles dans un milieu de vie sécuritaire adapté et respectueux. Nous ne pouvons pas accueillir les
homedesbayards.ch Home Des Bayards Résidence Personnes Agées
374 EEM ValdeRuz
2206
Les Geneveys-sur-Coffrane
Église Évangélique Missionnaire du ValdeRuz
eem-val-de-ruz.ch
375 ECOBuilding Concept ACCUEIL
1227
Les Acacias
... neuves en étudiant prioritairement les projets d'un point de vue écologique en minimisant d'une part les
eco-building.ch
376 IMed•ch | eHealth
2318
Les Ponts-de-Martel
... comprendre les facteurs à l'origine des nombreux échecs passàs et prà sents de mise en oeuvre du dossier
imed.ch
377 Home | www.agss.ch
1227
Les Acacias
... entreprises Sur le terrain Sections Cours au public Trouver les cours qui me sont utiles Sauveteur - Permis de
agss.ch
378 Hotel garni ancienne Fromagerie bedbreakfast
2722
Les Reussilles
Herzlich Willkommen auf der Website der Ancienne Fromagerie. ... Hotel - Garni " Ancienne Fromagerie" Les Reussilles Hotel Zimmer Preise Ausflüge Reservationen
ancienne-fromagerie.ch Bedbreakfast Les Reusilles 2722 Reitferien
379 AROLA Alfred Rochat
1346
Les Bioux
AROLA Alfred Rochat : Fabriquant de mouvements horlogers et de montres finies. Spécialisés dans ... construction se poursuit et les documents vont s'à toffer au cours des prochaines semaines. ​ Nouveau
arola-alfred-rochat.ch
380 ATec Saudan architecte
2206
Les Geneveys-sur-Coffrane
ATec saudan est un atelier d'architecture basé aux GeneveyssurCoffrane proche de Neuchâtel en Suisse. ... adresse e-mail est protégée contre les robots spammeurs. Vous devez activer le JavaScript pour la
atecsaudan.ch Architecte Architecture Concept Technique
381 GSHC Site officiel hockey
1227
Les Acacias
GeneveServette Hockey Club GSHC LNA club de ligue national A Suisse ... la news novembre En équipe Voir la news Toutes les news Focus sur # Juraj ?imek Voir la
gshc.ch Hockey Geneve Servette Patinoire
382 Union sportive Les PontsdeMartel hockey
2316
Les Ponts-de-Martel
L'Union sportive des PontsdeMartel regroupe trois groupements sportifs à savoir le FootballClub le ... Installation solaire Patinoire HC Les Ponts FC Les Ponts VBC Les Ponts
usplesponts.ch Hockey Football Volleyball Union Sportive
383 Vitreriecloux Accueil Vitrerie
1227
Les Acacias
Vitrerie miroiterie négoce de verre installation tout verre entretien de joint ... d'anciennes fenêtres ou vitrages pour les équiper de verres isolants. Nous entretenons les joints mastic sur
vitreriecloux.ch Vitrerie Miroiterie Négoce De Verre
384 Débouchage Vidange canalisation
2325
Les Planchettes
Entreprise spécialisée dans le débouchage le curage et lÂ?entretien de canalisations de toutes sortes ... Curage Caméra Sur le Ring Les Planchettes Tél. Accueil Spécialisée dans le
debouchage.ch Canalisation Débouchage Wc Curage Vidande Inspection Caméra Citerne
385 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h-h
android-phone.ch Htc Htc Suisse Samsung Suisse
386 Accueil
2345
Les Breuleux
... TABAC Stop Center menu Accueil Notre méthode Nos formules Thémoignage Qui somme-nous? Contact Les
tabacstopcenter.ch
387 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Cantonale Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h
windows-phones.ch Htc Htc Suisse Samsung Suisse
388 Auberge de l'Ours restaurant
1988
Les Collons
L'Auberge de l'Ours vous accueille dans son bar et son restaurant. Logement disponible. ... Cervin et la Dent-Blanche. Nous vous attendons avec impatience dès le décembre pour que les
alours.ch Restaurant Bar Club Auberge
389 URPC union
1080
Les Cullayes
Union Romande des propriétaires de Chiens ... Juridique Humeur Comportement Concours photos Conditions Générales Liens Contact À toutes les personnes
urpc.ch Union Romande Propriétaires Chien
390 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h-h
shop-htc.ch Htc Htc Suisse Samsung Suisse
391 Solutions Development coaching
1619
Les Paccots

solutionsdeveloppement.ch Coaching Coaching Practice Coaching Program
392 Microbrasserie du Pignon brasserie
1619
Les Paccots
La Brasserie du Pignon est une microbrasserie artisanale Suisse qui brasse ses bières avec de ... à chaque gorgà e - Bienvenue Microbrasserie artisanale situà e dans les Prà alpes Fribourgeoises la
brasseriedupignon.ch Brasserie Microbrasserie Suisse Biere Bière Bière Artisanale Houblon
393 Accueil iMoullet Architecture Sàrl Architecte
1865
Les Diablerets
Présentation de mon bureau d'architecture créé en avril 2010 ... district d’Aigle . La socià tà offre toutes les prestations lià es à l’exploitation d’un bureau
imoullet.ch Architecte Bureau D'architecture Cabinet D'architecture
394 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Cantonale Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h
pda-phones.ch Htc Htc Suisse Samsung Suisse
395 Accueil | www.pilatespassion.ch
2316
Les Ponts-de-Martel
... train. Pilates Passion Major-Benoit Les Ponts-de-Martel .. infopilatespassion
pilatespassion.ch
396 Accueil
1619
Les Paccots

ecorise.ch
397 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h-h
google-phone.ch Htc Htc Suisse Samsung Suisse
398 Nutriella
1227
Les Acacias
... santà ; des à tudes cliniques le prouvent! Il est donc possible d'à tablir le lien entre les habitudes
nutriella.ch
399 PDAPhone.ch Smartphone htc
1897
Les Evouettes
Smartphone téléphone mobile et tablette. Tout l'univers HTC et Samsung en Suisse PDAPhone.ch ... Les Evouettes Tél. Lundi mardi h-h Mercredi h-h/h-h
htc-accessoire.ch Htc Htc Suisse Samsung Suisse
400 Agence BAUMA immobilier immobilier
1865
Les Diablerets
Real Estate Brokerage ... adaptà e aux besoins du clients. Nous vous invitons à consulter rà gulièrement les objets que nous
bauma-immobilier.ch Immobilier Real Estate Propriété Property Properties Vaud Suisse
401 Bnblesrasses
1452
Les Rasses
... Accueil Tarifs Offres Contacts Photos Liens Livre d'or BnB Les Rasses Accueil Tarifs Offres
bnblesrasses.ch
402 Bike to futur
2416
Les Brenets

biketofutur.ch
403 123net
2316
Les Ponts-de-Martel
... solutions sur mesure Les dernières technologies Nous utilisons les technologies les plus récentes et les
123net.ch
404 Déménagement Genève transport
1227
Les Acacias
Vous cherchez sur Genève et sa région en Suisse un déménagement transport de meuble
cargouniversel.ch
405 Willkommen Chavacots
1619
Les Paccots
... Verkehr finden Sie hier . Prospekt Download Résidence Chavacots Chemin de l'Ermitage CH- Les
chavacots.ch
406 ACCUEIL Restaurant Le ACCUEIL
1862
Les Mosses
Hôtel Belair Leysin. Eté comme hiver le point de départ idéal pour vos activités ... Restaurant-Auberge INFO Site en cours de restructuration. Les fonctions principales restent opérationnelles
abcom.ch ACCUEIL
407 Services agricoles dedepannage
1607
Les Tavernes
services et ventes matériel agricole ... Toujours à votre disposition pour les services à domicile et autres réparations Dédépannage Sàrl
dedepannage.ch
408 Editions Hartwig Accueil Photos
1882
les posses-sur-bex
Les éditions hartwig présentent à travers des livres des photographies et des cartes ... à travers des mots et des images un monde où la poà sie est reine où les animaux sont rois... En
editionshartwig.ch Photos Photographies Photographie Naturaliste Photographie
409 Evole votre partenaire Evole
2416
Les Brenets
Fabricant suisse d'installations de traitement des eaux Evole est une entreprise à taille humaine
evole.ch Evole Traitement De L?eau Suisse
410 Bières vin et bières
2316
Les Ponts-de-Martel
Vente en ligne de bières de grande qualité à bon prix. Le spécialiste des bières ... CHF Château La Voulte-Gasparets Cuvée réservée Corbières AOC bouteille ml CHF Les
echoppeamalt.ch Bières Biere Specialite Bieres Conseil
411 Menuiserie Yvan Monard menuiserie
2316
Les Ponts-de-Martel
La Menuiserie Yvan Monard est à votre service depuis plus de 20 ans pour tous ... conseil ou un devis. Bonne visite et à bientôt ! Grande Rue ? Les Ponts-de-Martel Tél.
menuiseriemonard.ch Menuiserie Cuisines Escaliers Fenêtres
412 Excursion motoneige Canada Québec Randonnée
1862
Les Mosses
Motoneige Quebec Excursion en motoneige. ... qui vous conviendra. Une passion Au dà part c’est une passion pour la motoneige et les grands
motoneigequebec.ch Randonnée En Motoneige Sur Les Sentiers Balisés En
413 SP Massia spécialiste
1227
Les Acacias
SP Massia relevés laser surfacique (Lidar) et sousterrain (Ultrasons) modèle 3D intelligent ... Grâce à ses bureaux en Suisse en France au Pérou et au Bangladesh les équipes internationales de SP
spmassia.ch
414 Accueil | Sauvetage Le
2416
les Brenets
... Aller au contenu principal Sauvetage Le Locle Menu principal Accueil News Les cours Inscriptions La
sauvetage-lelocle.ch
415 Excursion motoneige Canada Québec Randonnée
1862
Les Mosses
StElieAventures. Excursion en motoneige au Canada Québec. ... qui vous conviendra. Une passion Au dà part c’est une passion pour la motoneige et les grands
st-elie-aventures.ch Randonnée En Motoneige Sur Les Sentiers Balisés En
416 Tennis club les brenets
2416
Les Brenets
... Tennis Club Les Brenets Accueil Le club Comité Tarifs Devenir membre Installations Agenda
tennisclublesbrenets.ch
417 ValdeRuz expo ValdeRuz
2206
Les Geneveys-sur-Coffrane
ValdeRuz expo se veut le nouvel emblème des commerçants du ValdeRuz et souhaite une synergie ... pendant plus de ans et réalisé un travail remarquable. Quel que soit son nom tant les exposants que
val-de-ruz-expo.ch ValdeRuz Expo Neuchâtel Suisse
418 Accueil Maréchalerie
2345
Les Breuleux
Bienvenue sur la page web de Adrien Boillat Maréchalerie Ferronnerie d?art Constructions ... Le Maréchal - Forgeron . ch Bienvenue sur la page web de Adrien Boillat et de Yvan Boillat
lemarechal-forgeron.ch Maréchalerie Ferronnerie D?art Constructions Métalliques
419 Home | www.agss.ch
1227
Les Acacias
... entreprises Sur le terrain Sections Cours au public Trouver les cours qui me sont utiles Cours Sauveteur
lesgestesquisauvent.ch
420 Bed Breakfast Les
2316
Les Ponts-de-Martel
Chambres d'hôtes aux PontsdeMartels Eveline Robert. ... Accueil Les chambres L?Orchidée Chambres standard Tarifs Plan d?acces Contact Lieux à visiter
lesprises.ch
421 Ama Zoothérapie Jura Suisse Zoothérapie
2336
Les Bois
Ama Jura Suisse. Association Médiation Animale. Activités zoothérapie assistées par l'animal. Contact travail animal. Parrainage. ... des animaux. Chercher AMA - Le Cerneux-Godat - Les Bois - - infol-ama template joomla
l-ama.ch Zoothérapie Animaux Médiation Animale Jura
422 Domaines d'activités | FM
1227
- Les Acacias
... FM Solutions Sàrl Rue Marziano CH - Les Acacias Genève - Suisse Téléphone Tél +
fmsolutions.ch
423 + + Auberge de
1833
Les Avants - Montreux
... Claudia Christian Mathey Auberge La Cergniaulaz • Les Avants Rà servations
lacergniaulaz.ch
424 Accueil Bagues
1400
Yverdon les Bains
Nous sommes spécialisés dans l'alliance et agent officiel St'Maurice. Toute notre équipe vous souhaite du plaisir ... Horlogerie Rue du Petit Chêne CH- Lausanne - Suisse Tél. + Cette adresse e
xel-or.ch Bagues Saint Maurice Alliances Saint Maurice
425 Accueil Olivier Flotron Olivier
1607
- Les Thioleyres
Olivier Flotron Le Sépey Les Thioleyres construction métallique entretient mécanique ... entreprise familiale est à votre disposition dans les domaines suivants Construction métallique en tout
flotron-olivier.ch Olivier Flotron Le Sépey
426 FANTASY SCULPTURES BY MARJOLAINE
1607
Les Tavernes - Vaud
... les photos soyez sympa de laisser mon nom dessus. Pour utilisation personel seulement pas de vente
marjolaine.ch
427 Transport de tourisme
1228
Plan les Ouates
Pour vos transports touristiques (voyage excursions en Suisse et en Europe) pour ... ses services de transports alliant confort et sécurité. Nous sommes spécialisés dans le tourisme les
odier-excursions.ch
428 Grande Boucherie du Molard
1228
- Plan les Ouates

boucheriemolard.ch
429 Chic Trendy Coiffure
1400
Yverdon les Bains
... approprié car notre désir est de respecter la nature de vos cheveux. Très à la mode aujourd'hui les mèches
chic-trendy.ch
430 CréaJob philanthropy
1227
Les Acacias GE
Based in Geneva Philanthropica works with individuals and institutions to enhance the impact of
creajobservices.ch Philanthropy Geneva Advice Advisors
431 Agie Chansons
1401
YVERDON LES BAINS
... « Au fil des couleurs » Présentation Actualité Agenda Discographie Galerie Media Contact Si les
agie-chansons.ch
432 36Chandelles.ch » Changements en
1400
Yverdon les Bains
... s?arrête cette année mais les ballons sont toujours disponibles en Suisse. Cependant par souci de respect
36chandelles.ch
433 Grande Boucherie du Molard
1228
- Plan les Ouates

viphost.ch
434 BMAutomobiles entretien et réparation Réparations
1807
Blonay - Les Chevalleyres
Réparations toutes marques pneus tuning occasions service automobiles multimarques ... Chemin des Fontanettes Blonay - Les Chevalleyres Contactez le pour plus de
bmautomobiles.ch Réparations Toutes Marques Pneus Tuning
435 LIBERTYHORSESHOW stage
2127
Les Bayards - Suisse
... - CH Les Bayards + ....
ecuriedelacombe.ch Stage équestre Camps Cheval écurie De
436 Spectacles magiques pour enfants
1228
Plan les Ouates
Le magicien professionnel Patrick Waltrick présente ses animations et spectacles de magie pour enfants. Découvrez ... Patrick Waltrick le magicien des enfants Les spectacles Le Voyage magique Spectacle pour écoles
magicien-suisse.ch
437 Enzocarrosserie.ch Accueil Enzocarrosserie
1400
Yverdon - les - Bains
Enzocarrosserie est située à Yverdon. Découvrez nos offres épargnez de 30% à 100% de ... ! Carrosserie Suisse Romande Le Relais Sarl Rue de Lausanne Yverdon - les - Bains Tà l
enzocarrosserie.ch Enzocarrosserie Enzo Carrosserie Enzo Stretti
438 Architecture Décoration et
1227
Geneva - Les Acacias - Switzerland
Maison Dupin : Architecture D?coration et design d'intérieurs Rue Marziano 22 1227 ... réalisations plans techniques Divonne Demeure Atmosphère Maison Zebrano Appartement Les Terrasses Fleuries
maison-dupin.ch
StadtBranche.ch Orts-Portrait von Les in Wallis Schweiz. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Les erhält 4 StadtBranche.ch Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt