optional Stadt:
Schweiz › Ort ›

Vers-l'Eglise › Waadt › Österreich › 1864 Erfahrungen

Branchenbuch Vers-l'Eglise

1864 Waadt

Kostenlos: Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie unser EBook "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 günstige Hochzeitsfotografie & coole Fotograf at
Die „Fotomacherei“ Mit einer „Macherei“ verbindet man etwas aus der Vergangenheit, etwas Altes, so wie zB. eine Greißlerei. Die Grundsätze von damals...
fotomacherei.at Vintage Fotobox Wohnwagen Lieben Hochzeiten Festgehalten Besuchen Webmaster Hochzeitseinladungende Unser Webseite Firmenevents Hochzeitsfotografie Fotografie Fotomachereiat Emma
2 find---me! Tiefschneeband Wintersport at
Die innovativen Tiefschneebänder für Tourenskifahrer, Freerider, Tiefschneefahrer und Variantenfahrer: find---me! ist nicht nur Fangschnur und Fangriemen gegen das Verlieren von...
find---me.com/ Shop Lawine Tiefschneeband Presse Tiefschnee Funktion News Sicherheit Ski Find—me Blog Skischulen Lawinenband Lawinen Tiefschneefahrer Menschen Videos Ernst
3 Body House Sonia Caparrelli Massage Wellness ch
Angebote im Body House Kradolf sind: Klassische Ganzkörpermassagen und Teilmassagen/ Ägyptos Ganzkörper Vital Wickel Detox ( Entgiftung und Straffung des...
epilsoft.ch/aegyptos-ganzkoerper-wickel-und-body-house/index.html Haarentfernung Epilsoft Pads Massagen Valuron Körperpflegestudio Body House Creme Kit Pflegeprodukte Damenbart Hair Men Natürlich Kosmetik Wachs
4 Bedruckte Papiertragetaschen mit Logo Werbeartikel at
Werbetaschen aus Papier mit Firmenlogo gesucht? Das Unternehmen GWV GmbH aus Oberösterreich produziert bedruckte Papiertragetaschen. Das Sortiment enthält dabei Papiertragetaschen...
5 Feuershow & Lichtshow Feuershows - ch

Art of flames bietet Feuershows und Lichtshows mit einer einmaligen Kombination aus Akrobatik, Tanz und Bewegung, synchronisiert zur Musik. Buchen...
art-of-flames.ch Feuershow Basel Schweiz Deutschland Lernen Share Frankreich Mich Lichtshow Feuershows Bewegung Musik Tanz Akrobatik Besonderen Eng
6 pferdegestütztes Training Training at
Im pferdegestützten Coaching erleben Sie emotionale Höhepunkte, dadurch bleiben die erarbeiteten Inhalte länger in Erinnerung. Durch die Arbeit mit Pferden werden...
horseforcompany.at/ Coaching Training Methoden Pferdegestütztes Workshops Konfliktmanagement Pferde Pferden Horse Wirkung Stressabbau Themen Selbstmanagement Ergeben Company Unbestechlichen Präsenz Ungeschminkt
7 günstige Hochzeitsfotografie & coole Fotograf at
UNVERGESSLICHE MOMENTE – FESTGEHALTEN VON UNS „Wir lieben Fotos! Und wir lieben Hochzeiten!“ – Wir begleiten euch, um den schönsten Tag...
fotomacherei.at Vintage Fotobox Wohnwagen Besuchen Webmaster Hochzeitsfotografie Lieben Hochzeiten Mycardshopde Hochzeitseinladungende Firmenevents Fotomachereiat Webseite Unser Fotografie Firmenevent
8 Hotel Stadt Wien Zell Hotel at
Zell am See
Das Familienhotel und Ferienhotel Stadt Wien begeistert zu allen Jahreszeiten: Das Hotel in Zell am See in der Region Pinzgau...
9 Vorwerk Staubsaugerbeutel Vorwerk Staubbeutel Service und at
Vorwerk Staubsaugerbeutel Vorwerk Staubbeutel Vorwerk Filtertüten Vorwerk Zubehör Vorwerk Ersatzteile für Vorwerk Tiger 250 Vorwerk Tiger 251 Vorwerk Tiger 252...
staubsauger-service.jimdo.com Z Y
10 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
11 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
12 Kirby Staubsaugerbeutel Kirby Staubbeutel Service und at
Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten Kirby Staubsaugerbeutel Kirby Staubbeutel Kirby Filtertüten für Kirby Sentria Kirby Ultimate Kirby Diamond Kirby...
13 Cannabis King CBD Online ch
Le Mont Pèlerin
Cannabis King – Der online shop für CBD Blüten und Zubehöre. Unser Team ist ständig auf der Suche die besten Produkte...
14 Vortech Force Staubsaugerbeutel Vortech Service und at
Vortech Force Staubsaugerbeutel Vortech Force Staubbeutel Vortech Force Zubehör Vortech Force Staubsauger Zubehör Vortech Force Staubfilter für Vortech Force XR-3000...
vortech-force-staubbeutel.jimdo.com Z Y
15 Sakura Zubehör Sakura Staubsauger Service und at
Sakura Zubehör Sakura Staubsauger Zubehör Sakura Staubsauger Service Sakura Ersatzteile Sakura Service Sakura Staubsauger Ersatzteile Firma Haushaltsgeräte Rozenich Erreichbar Mo...
sakura-staubsauger-service.jimdo.com Z Y
16 Ipoh Cuisilux Zubehör Ipoh Service und at
Ipoh Cuisilux Zubehör Ipoh Cuisilux Ersatzteile Ipoh Cuisilux Service Ipoh Cuisilux Kundendienst Ipoh Cuisilux Kundenservice Ipoh Cuisilux Reparatur Firma Haushaltsgeräte...
ipoh-cuisilux-zubehoer-ipoh.jimdo.com Z Y
17 Ipoh Bio Universalgerät Zubehör Service und at
Ipoh Bio Universalgerät Zubehör Ipoh Bio Universalgerät Ersatzteile Ipoh Bio Universalgerät Service Ipoh Bio Universalgerät Kundendienst Ipoh Bio Universalgerät Reparatur...
ipoh-kuechenmaschine-ipoh-cuis.jimdo.com Z Y
18 Ipoh Küchenmaschine Zubehör Ipoh Service und at
Ipoh Küchenmaschine Zubehör Ipoh Küchenmaschine Ersatzteile Ipoh Küchenmaschine Service Ipoh Küchenmaschine Kundendienst Ipoh Küchenmaschine Kundenservice Ipoh Küchenmaschine Reparatur Firma Haushaltsgeräte...
ipoh-kuechenmaschine-zubehoer.jimdo.com Z Y
19 Ipoh Küchenmaschine Zubehör Ipoh at
Ipoh Küchenmaschine Zubehör Ipoh Küchenmaschine Ersatzteile Ipoh Küchenmaschine Service Ipoh Küchenmaschine Kundendienst Ipoh Küchenmaschine Kundenservice Ipoh Küchenmaschine Reparatur Firma Haushaltsgeräte Rozenich...
20 Lura Wasserstaubsauger Zubehör Lura Service und at
Lura Wasserstaubsauger Zubehör Lura Staubsauger Zubehör Lura Zubehör Lura Wasserstaubsauger Ersatzteile Lura Staubsauger Ersatzteile Lura Ersatzteile Lura Kundendienst Lura Service...
lura-wasserstaubsauger-lura.jimdo.com Z Y
21 Thermostar Dampfreiniger Zubehör Thermostar Service und at
Thermostar Dampfreiniger Zubehör Thermostar Zubehör Thermostar Avantgarde Dampfreiniger Thermostar Professional Zubehör Thermostar Avantgarde Zubehör Thermostar Dampfreiniger Kundendienst Thermostar Dampfreiniger Ersatzteile...
thermostar-dampfreiniger.jimdo.com Z Y
22 Linetti - Spezialist für Schlafsysteme at
Verantwortungsvolle Konsumenten, die einen online Möbel-Shop suchen, werden auf Linetti Living fündig. Neben Bettenkollektionen aus verschiedensten Vollhölzern, komfortablen Schlafunterlagen in...
23 SAP FICO Freelancer SAP Consulting ch
Als erfahrener SAP Freelancer im Bereich Finanzen & Controlling (FI CO PS IM) stehe ich Ihnen für Ihr SAP-Projekt zur...
sap-fico-freelancer.ch Fico Sap Freelancer Consultant Shana Einführung Berater Controlling Schweiz Schulungen Konzeption Co Systemhaus Design Kostenträgerrechnung Customizing Profit Center Go Live Rechnung
24 Venatores Personalberatung at
venatoresmp.com Z Y
25 Busundco. Unternehmen at
26 Busundco. Unternehmen at
27 Busundco. Unternehmen at
28 Busundco. Unternehmen at
29 Embabox Verpackung at
Stilvolle Verpackungen aus natürlichem Holz. Direkt vom Produzenten. Individuell und punktgenau personalisiert. Seit 1918. Damit ist alles gesagt. Gefragt ist...
embabox.com Mein Anmelden Warenkorb Weinboxen Geschenkverpackungen Holzwolle Genussboxen Outlet Konto Kasse Embabox Holzverpackungen Muster Widerrufsformular Weinkisten Ab Ihrem Kategorien Tortenkisten
30 Nagelstudio Kosmetik Beauty at
Nagelstudio, Nails, Nagel, Wimpern, Wimpernverlängerung, Permanent Make Up, Tattoos, Salzburg, Günstig, professionell, Pflegeprodukte, Nuskin,...
nagel-und-beauty.at Permanent Nageldesign Nagel Kurse Schönheitstattoos Ausbildung Schönheit Wege Ich | Seitehin Homepagetattoos Stimme
31 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
32 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
33 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
34 Basads.ch - Gratis-Inserate Schweiz Kleinanzeigenmarkt ch
Wer Gebrauchtgegenstände verkaufen möchte, kann auf einem lokalen Flohmarkt sein Glück versuchen. Eine andere Möglichkeit findet sich im Internet. Hier...
35 SV-Weber Betriebswirt-Rechtsökonom-Sachverständiger-Honorarberater Sachverständige Gutachter at
SV-Weber Betriebswirt-Rechtsökonom-Sachverständiger-Honorarberater für Finanzierung, Kredit, Darlehen, Leasing und Investition, Kreditsachverständiger/Kreditgutachter für das Kreditwesen, Kapitalwesen und Bankwesen, Rechtsökonom für das Vertragswesen,...
36 Reiteralm & Fageralm Bergbahnen Bergbahnen at
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
37 Reiteralm & Fageralm Bergbahnen Bergbahnen at
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
38 Reiteralm & Fageralm Bergbahnen Bergbahnen at
Die Skiberge Reiteralm und Fageralm laden im Skiurlaub oder Winterurlaub zum ausgedehnten Skifahren und Snowboarden ein. Die Reiteralm sowie die...
39 Darlehen ab 10.000 € Finanzierung Online at
Guten tag Wir sind eine institution, die von micro finance bieten wir lösungen für einfache finanzierung in form von hypotheken. Wir bieten...
stadtbranche.at Ratgeber Mopswelpen Wien Klöster Magazin Boote Unternehmen Erfahrung Stadtbrancheat Media Partner Tschagguns Klösterreich Band Österreich Haltung * Championzucht Social Sportbootverleihauch
40 Küken Junghennen und Stalltechnik Landwirtschaft at
Spitzenqualität, Kundenservice und Partnerschaft – dafür steht der Name Schropper seit über 85 Jahren. Das Know-how beruht auf der langjährigen...
41 Zahnärzte Amodent Zahnarzt at
Graz, 02. Bezirk: Sankt Leonhard Graz
Ihr Zahnarzt in Graz Leonhardstraße 56. Die Praxisgemeinschaft Amodent bietet allgemeine Zahnheilkunde und Kieferorthopädie unter einem Dach. Für eine optimale...
amodent.at Graz Amodent Prophylaxe Assistentin Zähne Team Zahnarzt Tage Termin Zhne Schwellungen Wunde Zahnärztliche Prof Behandlung Zahnärzte Straß Jahren Wattestbchen
42 Bonsai-Studio Emmi Bonsai ch
Ihr Bonsai-Spezialist mit über 15 Jahren Erfahrung Pflege & Gestaltung von Bonsai und Gartenbonsai-Pflanzen Beratung, Formschnitt, Formgebung mit Draht, Neu- und...
bonsai-studio.ch Emmi Bonsai Studio Beratung Projekt Ferienpension Baum Pflege Uns Studioch Kauf Gallery Kontaktaufnahme Unterhaltkleindöttingen
43 Übersetzungsbüro Englisch Russisch und Übersetzungen Übersetzer at
Übersetzungen in den Sprachen Englisch, Russisch und natürlich Deutsch in allen Kombinationen. Zusätzlich zu den bekannten Tätigkeitsbereichen eines klassischen Übersetzungsbüros...
44 mbs Transporte at
Wolfurt Vorarlberg
Transporte EU weit bis 1, 5 Tonnen , Kleintransporter mit Anhänger bis 3, 5 Tonnen. 7 tage die Woche ...
mueller-boten-service.eu Z Y
45 Auto-Motorrad und Bootsfahrschule Fahrschule ch
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
fahrschule-schaer.ch Z Y
46 Auto-Motorrad und Bootsfahrschule Fahrausbildung ch
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
47 Auto-Motorrad und Bootsfahrschule Fahrausbildung ch
Führerschein leicht gemacht. Ich mache Sie mobil. Die Fahrschule Schär aus Horw bietet eine fundierte Ausbildung auf dem neusten Stand...
48 Bouillon Saucen Würzmittel Gesunde Nahrung ch
Nahrungsmittel ohne tierische Fette. Bouillon: Suppella Bratensauce: Sossella Würzmittel: Salatfein, Kräutergewürzsalz, ...
dreizehnter.ch Suppe Bouillon Allwürzmittel Hühner Klare Feine Suppella Asal Sauce Tellofix Sosse Helle Delikatess Bratensoße Grill Rinds Dreizehnterch
49 Klösterreich - 24 Klöster Kloster at
Straß im Straßertale
Die 24 Klöster und Stifte des Klösterreichs haben viel zu bieten. Eine große Palette von Festen und Veranstaltungen gibt es...
kloesterreich.at/home/ Stift Klösterreich Kloster Videos Pilgern Zeit Musik Kultur Klöster Gesundheit Gärten Einkehr Exerzitien Gast Besinnung Klostergarten
50 Klösterreich - 24 Klöster Kloster at
Straß im Straßertale
Die 24 Klöster und Stifte des Klösterreichs haben viel zu bieten. Eine große Palette von Festen und Veranstaltungen gibt es...
51 MindSpirit Hypnosetherapie & Mental Coaching Hypnose ch
WIRKSAME VERÄNDERUNG MIT EFFIZIENTEN METHODEN Erfolgreiches und nachhaltiges Coaching oder Therapie muss nicht lange dauern. Mit MindSpirit Hypnosetherapie und Mental Coaching...
mindspirit.ch Hypnosetherapie Coaching Mindspirit Mental Mich Termin Teilen Kosten Hypnorelax Kostenlosen Lange Effizienten Info[at]mindspiritch | Wirksame
52 Flyer verteilen Flyerverteilung Zürich ch
Glattbrugg Zürich
Flyer verteilen in Zürich ab CHF 85.-- Flyer veteilen in Basel ab CHF 100.-- Flyer veteilen in allen Bezirken Kt. Zürich ab...
flyer-verteiler.ch Z Y
53 wohnboutique Haushalts- & ch
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
54 wohnboutique.ch Haushalts- & ch
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
55 wohnboutique.ch Haushalts- & ch
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
56 Trauerbegleitung Beratung ch
Die Lebens- und Trauerbegleitung hilft und unterstützt dort, wo es weh getan hat. Verluste sind nicht einfach zu verkraften und...
lebenundtrauern.ch Z Y
57 Agrarimmobilien Immobilien ch
Auswanderung effizient angehen, damit die Suche nach einer Wunschliegenschaft erfolgreich verläuft! Zu den alternativen Auswanderungsländern für junge Bauern und Bauernfamilien zählt...
58 Agrarimmobilien Immobilien ch
Auswanderung effizient angehen, damit die Suche nach einer Wunschliegenschaft erfolgreich verläuft! Zu den alternativen Auswanderungsländern für junge Bauern und Bauernfamilien zählt...
59 Strategisches Marketing Marketing at
Wir kümmern uns um die Konzeptionierung und Strategische Planung von Unternehmen und Produkten in den Bereichen Geo-Marketing, für die Regionen...
blue-wavez.com Marketing Agentur Partner Wavez Webdesign Blue Strategische Agency Company Creative Funstuff Projectmanagement Project Kontaktieren Privatsphäre Services Liegt Careers
60 David Umzug Umzug ch
Bern, Switzerland
Wir machen jede Art von Umzügen. Wohnungsumzüge, Hausumzüge, Umzüge innerhalb von Bern oder in jeder Stadt in der Schweiz, internationale...
david-umzug.ch Umzugsfirma David Bern Umzug Umzüge Anfrage Senden Wordpressorg Rss Entries Zimmer Angebot Möbelpacker Umzugsunternehmen Schweiz Habseligkeiten Umzugsmit
61 Christoph Schlick - Logotherapie Logotherapie at
Christoph Schlick bietet neben Coaching und Training im Bereich Persönlichkeitsentwicklung und Persönlichkeitsbildung auch Seminare und Vorträge zum Thema Sinnsuche, Lebensgestaltung...
christophschlick.com/ Seminare Vorträge Christoph Schlick Information Blog Pressespiegel Meine Partner Leistungen Mein Vision Leben Salzburg Coachings Bietet Beratung
62 SiBO Verpackungen Bernd Hesse Verpackung at
Wenden - Gerlingen
1948 gegründet, zählt SiBO - Verpackungen heute zu den innovativsten Unternehmen in der Verpackungsbranche. Stetige Investitionen in die Produktion, die...
63 SiBO Verpackungen Bernd Hesse Verpackung at
Wenden - Gerlingen
1948 gegründet, zählt SiBO - Verpackungen heute zu den innovativsten Unternehmen in der Verpackungsbranche. Stetige Investitionen in die Produktion, die...
64 ecscad ecscad Elektrotechnik Engineering ch
EFFIZIENT und PRÄZISE! Elektrodokumentation mit ecscad Aber nicht nur das! ecscad kann mehr als nur Stromlaufpläne Die Elektro-CAD / CAE-Software ecscad wird mit...
ecscad.ch Ecscad Stromlaufpläne Mechatronik Planung Cad Software Schaltpläne Instandhaltung Daten Support Elektro Ob Cae Stellt Projekte Struktur Français Vorliegenverschmelzung
65 Catalea Fashion - Bekleidung Bekleidung Großhandel at
Bergheim bei Salzburg
Catalea Fashion - Bekleidung Großhandel für Wiederverkäufer. Von Damenmode bis zu Taschen, Accessoires u.v.m. Qualitätsmode Großhandel für gewerbliche Kunden....
cataleafashion.com Großhandel Uns Taschen Fashion Bekleidung % Textil Accessoires Sommerkleid Free Catalea Damenmode Shop Mein Konto Mäntel
66 Die besten Siebträgermaschinen im Vergleich Die besten Siebträgermaschinen im Espressomaschinen at
Feldkirchen in Kärnten
Alle Infos über aktuelle Siebträgermaschinen: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
67 Die besten Siebträgermaschinen im Vergleich Die besten Siebträgermaschinen im Espressomaschinen at
Feldkirchen in Kärnten
Alle Infos über aktuelle Siebträgermaschinen: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
68 Die besten Flachbettscanner im Vergleich Die besten Flachbettscanner im Scanner at
Alle Infos über aktuelle Flachbettscanner: Preisvergleiche, Testberichte, Ratgeber und wissenswerte Informationen rund um Technik und Funktionen. Zudem liefern interessante Blogberichte wertvolle...
flachbettscanner-vergleich.de/ Flachbettscanner Vergleich Canon Epson Mwst Kauf Preis Software Hersteller Fotoscanner Avision Kaufen Scanner Dokumentenscanner Test Multifunktions Druckern Ratgeber Iochow Fazit Bandbreite
69 CBD & Superfood Onlineshopping ch
Liebhaber von Hanfprodukten, die in der Schweiz leben oder hier über eine Postadresse verfügen, haben gut lachen: Produkte auf Basis...
70 Brennholz Kaminholz Brennholz Kaminholz at
Bad Eisenkappel
Splitterfrei, sauber, unter 18% Feuchtigkeit. Mit unserem österreichischen Holz wird Heizen zum Vergnügen. Zustellung österreichweit....
buchen-brennholz.at Here Directions Brennholzat | Agb Wwwbuchen Httpwwwtraussnigat Warmesoffice@buchen Behagliches Wohnen Extras + Preise
71 Kreditvergleich24 Finanzen ch
Kredit Vergleich 24 ist die seriöse Finanzierungsgesellschaft betreffend Finanzierungen, Darlehen und mehr. Bezüglich Kredite bieten wir unter anderm Kleinkredite sowie...
kreditvergleich24.ch/ Schweiz Kredit Kreditvergleich Günstige Privatkredit Sofortkredit News Kredite Beantragen Kleinkredit Kleinkredite Funktionert Unternehmen Privatkredite Kreditantrag Zürich West
72 Suchmaschinenoptimierung · SEO SEO at
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
73 Sichtschutz Zauntechnik at
Leopoldsdorf bei Wien 
M-tec technology Sichtschutz in Österreich Bei M-tec technology GmbH finden Sie Zaunblenden zum blickdichten Einflechten in Ihren Gittermattenzaun. Wählen Sie...
m-tec-sichtschutz.at/ Tec Pvc Sichtschutz Einflechten Sichtschutzstreifen Profi Design Line Streifen Muster Zaunblenden Print Hart Shop – Erfolg
74 Suchmaschinenoptimierung · SEO SEO at
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
75 Suchmaschinenoptimierung · SEO SEO at
Jede Wirtschaftsbranche ist von der Digitalisierung betroffen. Nur Unternehmen, die sich rechtzeitig für die dadurch entstehenden Veränderungen fit machen, sind...
webwest werbeagentur
76 PREISJASSEN Jassturnier ch
Samstag, 23. Sept. 2017 Im ehemaligen Rest. Alexander heute Rest. Pizza Blitz Riehenring 85 4058 Basel Besammlung 13:30 Uhr Beginn...
77 PREISJASSEN Jassturnier ch
Samstag, 23. Sept. 2017 Im ehemaligen Rest. Alexander heute Rest. Pizza Blitz Riehenring 85 4058 Basel Besammlung 13:30 Uhr Beginn...
78 Prime Models | die Modelagentur ch
St. Gallen
Wir von Prime Models sind die Modelagentur wenn es um Vielseitigkeit, Geschwindigkeit, Kreativität und Einzigartigkeit geht. Lassen Sie sich positiv...
79 Oberwaid Private Clinic Private Clinic ch
St. Gallen
Oberwaid is a luxury wellness hotel situated near the beautiful Lake Constance. Apart from luxury accommodation, its private clinic has...
oberwaid.ch/privatklinik/medizin-gesundheit.html Oberwaid Privatklinik Medizin Gesundheit Hotel Gesund Team Behandlungskonzept Patienten Therapieangebot Swiss Indikationen Kur Photohrapher Coaching Oase Traditionelle
80 Wohnboutique.ch - Online Shop Haushalts- und ch
Wir sind ein Online Shop mit Produkten für Haushalt & Geschenke. Dies für Schlafzimmer, Wohnzimmer, Badezimmer, Reisen, Küche etc. finden...
81 Praxis Krebs & Martin Zahnarzt ch
Ihre Zahnärzte und Spezialisten für Implantate in Luzern. Das gesamte Spektrum der Zahnmedizin. Mit Erfahrung von über 5000 gesetzten Implantaten....
zahnarzt-praxis-luzern.ch Dr Krebs Martin Luzern Zahnarzt Zahnmedizin ✚ Termin Implantate Erfahrung Server English Angstpatienten Prothesenhalt Weisheitszähne
82 Partnerseminar Seminar at
Kirchberg am Wechsel
GÖNNEN SIE SICH EIN WOCHENENDE NUR ZU ZWEIT !! Verliebt zu sein – reicht es für eine gute Partnerschaft aus ? Jeder...
positive-sense.at Mentaltraining Kinesiologie Birkenbihl Vera Jugendliche Unternehmen Mobbing Kinder Lernen Balance Gehirngerechtteam Arbeiten Gelassenheit
83 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
84 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
85 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
86 WS Wasserenthärtung Schweiz GmbH Wasseraufbereitung ch
Die Firma WS Wasserenthärtung Schweiz GmbH ist auf den Vertrieb von Entkalkungsanlagen spezialisiert. Hartes Wasser ist der Hauptgrund für verkalkte...
87 Priv. Doz. Dr. med. Plastische und ch
Mein Spezialgebiet in der Praxis für Plastische und Ästhetische Chirurgie ist die plastische und ästhetische Brustchirurgie und Körperchirurgie. Auf diesem...
plastische-chirurgie-in-basel.ch Dr Med Erfahren Chirurgie Brust Spezialisten Doz Gesicht Priv Kosten | Torio Körper Iblher Voigt Info@plastische Baselch
88 Priv. Doz. Dr. med. Plastische und ch
Mein Spezialgebiet in der Praxis für Plastische und Ästhetische Chirurgie ist Gesichts- und Nasenchirurgie. Ich habe 2010 meinen Facharzttitel für...
plastische-chirurgie-in-basel.ch Med Erfahren Dr Brust Spezialisten Priv Gesicht Chirurgie Doz Torio Kosten Jameda Körper Iblher Voigt Info@plastische Baselch
89 Prof. Dr. med. Nestor Plastische und ch
2009 erlangte Prof. Dr. med. Nestor Torio seinen Facharzttitel für Plastische und Ästhetische Chirurgie. Zwischen 2009 und 2014 war er...
plastische-chirurgie-in-basel.ch Erfahren Dr Med Chirurgie Gesicht Spezialisten Brust Doz Priv Iblher Torio Jameda | Kosten Körper Baselch Info@plastische
90 Ried Verpackungssysteme GES.M.B.H Verpackungen at
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
91 Ried Verpackungssysteme GES.M.B.H Verpackungen at
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
92 Ried Verpackungssysteme GES.M.B.H Verpackungen at
Ried-Foodpack offeriert Lebensmittelverpackungen zugeschnitten für Lebensmittelhändler und Gastronome. Eine Vielzahl an Verpackungsmarterialen stehen zur verfügung. Neu: Verpackungen aus Bio-Plastik (PLA). Außerdem...
93 Verband Schweizerischer Laien- und Berufsverband ch
Der VSLFR setzt sich für die Mitwirkung von Fach- und Laienrichtern im Justizsystem und für die Förderung der Kompetenzen seiner...
vslr.ch Z Vslr Y
94 Praxis für Plastische Chirurgie Plastische und ch
Unsere Praxis zählt zu den führenden Zentren für Plastische und Ästhetische Chirurgie in der Nordschweiz und verfügt über modern ausgestattete...
plastische-chirurgie-in-basel.ch Med Erfahren Dr Priv Brust Doz Gesicht Chirurgie Spezialisten Körper Kosten Jameda Torio Iblher Voigt Info@plastische Baselch
95 SchleifMaster - Friseurscheren Schleifservice SchleifMaster - Friseurscheren Schleifservice Schleiferei at
Die Firma SchleifMaster aus Solingen ist Ihr professioneller Friseurscheren-Schleifservice. Wir sind auf das Schleifen und Reparieren von hochwertigen Friseurscheren spezialisiert. Ob Scheren...
friseurscheren-schleifservice.at Schleifen Scheren Friseurscheren Schleifauftrag Preise Joewell Schliffarten Auftrag Leader + Schleifservice Linkshandscheren Hohlschliff Diavolo Cam✓ Japanische
96 Hochzeit-selber-planen Dienstleistung at
Alles rund um Ihre perfekte Hochzeit finden Sie auf unserer Seite. Alles was Sie nur brauchen können Sie in unserem...
hochzeit-selber-planen.com Hochzeitsplanung Hochzeit Flitterwochen Tipps Hochzeitsspiele Knigge Trauung Hochzeits Hochzeitsplaner Hochzeitstorten Hochzeitsgäste Planen Catering Hochzeitskosten Hochzeitsbräuche Ratgeber Hochzeitsfest
97 pure life – Zentrum Ernährung at
Das pure life Salzburg ist das Kompetenzzentrum zum Thema Ernährung, metabolic balance Stoffwechselprogramm, Stoffwechselkur, gesund abnehmen sowie Nahrungsergänzung und Beratung...
pure-salzburg.at/ Pure Salzburg Life Ernährung Vita Conny Youtube Rezepte Metabolic Hörl Club Balance Kompetenzzentrum Gtgt Abnehmen Radikale Testungen Hcg Diät Light Gesunder Innerhalb
98 prime Kosmetikstudio Salzburg Kosmetikstudio at
Kosmetikstudio in Salzburg Stadt für professionelle Beauty und Kosmetik Behandlungen gesucht? Prime bietet nicht nur Gesichtbehandlung, Microdermabrasion, Make-Up, Haarentfernung und...
99 Online Shop für Hanf Lebensmittel Tabak ch
Mr. Hemp ist dein schweizer Onlineshop für CBD und Hanfprodukte in der Schweiz. Wir bieten eine grosse Auswahl an CBD...
mrhemp.ch Cbd Mrhemp Bieten Cannabis Mr Uvmneu Amp Sonnenfeld Schweiz Hanfnatur Hemp Superfoodmrhemp Lebensmittel Marken Hanfoumll Budz
100 Wespen Notdienst Schädlingsbekämpfung at
Ihr Spezialist für Wespen und Hornissen Evakuierungen und Bekämpfung in Kärnten!...
vespix.at Valid Wespen Umsiedelungen Klagenfurt Vespix Wölfnitz Steinacher Xhtml Insektenbefall Hummeln Wespenbekämpfung Hornissenstiche Preise Inhaber Hornissenbekämpfung Zuhause Wespennotdienst Css
101 InCoFin GmbH & Co.KG Finanzberater Finanzberatung ch
Ihr Berater in Sachen Finanzen aus Recklinghausen. Seit mehr als 15 Jahren unterstützen wir Konsumenten beim auswählen von korrekten Vorsorge-...
unabhaengiger-finanzberater.de Ort Sparen Berater Uns Portal Honorarberatung Erfolgreich Finanzberatung Beratungsabläufe Unabhängige Unabhängiger Vermögen Finanzberater Eigenkapitalbeschaffung Altersvorsorge Ihr Kredite
102 Tourismusverband Goldegg am See at
Wer unvergessliche Ferien in Salzburg erleben will, der checkt ein für einen Urlaub in einer der Unterkünfte in Goldegg am...
goldeggamsee.at/ Goldegg See Goldegger Kultur Genuss Tradition Familie Erlebnis Romantik Urlaub Tour Unterkünfte Golfen Wandern
103 Logo Erstellung zum günstigen Logo Design ch
Filogo ist eine kleine Design Agentur mit Sitz in der Schweiz, welche sich auf das Erstellen professioneller Logos für Firmen...
104 Überwachungskamera Set Ratgeber at
Wir bieten einen Ratgeber zum Thema Überwachungskamera Set. Wir stellen unterschiedliche Typen von Überwachungskameras vor und erklären die Vor- und...
ueberwachungskamera-set.org Wlan Mwst Kaufen Winkel Set Kabel Dome überwachungskamera Modelle Netgear Arlo ° Kameras Außen Innen Modell Ptz Fähig Bauart Ptz Fähig Wandarm Dome Wandarm Innen Hd Aufzeichnung Kamera Die Anwendungsfälle
105 Finest Homes Immobilien Salzburg Immobilien at
Finest Homes bietet Luxusimmobilien in der Stadt Salzburg ebenso wie im Salzburger Land im Seengebiet und im Salzkammergut. Informieren Sie...
finest-homes.com/ Salzburg Wohnungen Grundstücke Häuser Verkaufte Homes Seeliegenschaften Finest Villen Neubauimmobilien Bauernhäuser Penthousewohnungen Land Luxusimmobilien Immobilien Wertermittlung Verkauf Stadt Uns
106 Finanzielle Hilfen Dringende für Investor Gesucht ch
Sehr geehrter Kreditsuchender, Ich biete von Darlehen in der Höhe von 1000 € bis 10.000.000 € für Privatpersonen und Unternehmen...
107 Mehr Ihre Bank für Finanz at
Hallo Herr und Frau .; Sie suchen entweder heben Sie Ihre Aktivitäten für die Finanzierung, ob für ein Projekt oder eine...
108 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
109 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
110 Kieferorthopädische Praxis Dr. Alexandra Kieferorthopäde at
Dr. Alexandra Scherer ist Spezialistin für Kieferorthopädie. Für Zahnkorrektur und Kieferregulierung mit Zahnspange für Kinder, Jugendliche oder Erwachsene, ist Kieferorthopäde...
111 schlau-finanziert Finanzierungsvermittlung GmbH Finanzierungsvermittlung at
Oberndorf b. Salzburg
schlau finanziert – Wir vergleichen Konditionen Für Ihre Immobilienfinanzierung vergleichen wir als unabhängige Finanzierungsvermittler Angebote von über 50 Banken und Bausparkassen....
schlau-finanziert.at/ Partner Miete Eigentum Vergleichen Berechnen Kreditumschuldung Finanzierungsanfrage Kreditrate Budgetrechner Kreditrechner Immobilienfinanzierungen Besten Förderungen Finanziertat Beratung Bau Zahlen
112 Finanzdienstleistung für verwirklichung ihrer Angebote ch
Zur Realisierung Ihrer Projekte bieten wir die Möglichkeit der kurzfristigen Kredite an mittel mit einem flexiblen Tilgungsplan und einem jährlichen...
12 rue de nice
113 Fotostudio Gianni Groppello Fotografie ch
Gianni Groppello ist ein Fotograf aus Basel, der im Jahr 2007 seine Leidenschaft zum Beruf gemacht hat. In diesem Jahr...
gianni-groppello.com Z Y
114 Künstlerische Fotografie Fotografie at
3100 St. Pölten
Meine bevorzugten Themen sind Porträt-Fotografie, Spirituelles, Natur-und Makrofotografie, People/Children-Fotografie, Experimente, Impressionen, Fotoreisen. ​Seit 6 Jahren leite ich Foto-Workshops für Jugendliche an...
jaeggi-fotoart.com Fotografie Workshops Experimente Foto Children Spirituelles People Waldviertel Nude Impressionen Reisen Galerie News Nordalbanien Ua Hin Landschafts Erstreckt
115 Spin IT IT EDV at
Wir bieten individuelle und kostengünstige IT Lösungen für Klein- und Mittelbetriebe. (Web- und Grafikdesign, Verarbeitung von Geodaten, Netzwerk und Server...
spin-it.at Spin Server Sicherheit Entertainment Reparatur Virenschutz Dienstleistungen Geoinformationssysteme Konfiguration Netzwerk Spindler Notebook Pc Backup Computer Virtualisierung Wlan Geräteund
116 Hotel in Grindelwald Hotels ch
Wichtig für Ihre schönen Reise- und Urlaubserlebnisse ist auch die Wahl des richtigen Hotels. Deswegen bieten wir Ihnen als Kooperation...
hotel-in-grindelwald.com/ Grindelwald Scheidegg Restaurant Ferienregion Hotel Gastronomie Jungfrauregion Kleine Berner Jungfraujoch Unesco Welterbe Hotels Grosse Wanderwege Grindelwalder Aussichtspunkte Europe Zahlreichen
117 Autoglas Mobil Service Landshut Autoreperatur ch
Autoglas Landshut, Straubing, Mauern, Moosburg, Freising, Erding. Heimservice für Windschutzscheiben, Frontscheiben o. Heckscheiben. Windschutzscheiben repair. Scheibenwechsel, Autofenster reparieren, wechseln....
autoglas-bayern.de Autoglas Heimservice Landshut Straubing Windschutzscheiben Partner Moosburg Deggendorf Terminvereinbarung App Regensburg Versicherungen Qualität Leihwagen Sonnenschutz Store Eching Wörth
118 PROTECARS - The good Limousinen Service ch
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
119 PROTECARS - The good VIP Shuttle ch
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
120 PROTECARS - The good VIP Shuttle ch
- Sicherheitsdienst & VIP Shuttle in der Schweiz - Protecars ist Ihr zuverlässiger Sicherheitsdienst in Basel und Umland für private und...
121 Hypnose-Therapie Gesundheit Pschologie ch
Nutzen der Therapie: Sie lösen ihre Ängste, Phobien und Blockaden auf Sie steigern ihr Selbstvertrauen und maximieren ihren Selbstwert Sie werden Rauchfrei oder...
122 Motomi GmbH | Gebrauchtwagenbörse Gebrauchtwagenhandel at
Klagenfurt am Wörthersee
Gebrauchtwagenbörse für Händler und private Verkäufer. Bis zu 2 Fahrzeuge gratis inserieren. Autobörse für Gebrauchtwagen, Jahreswagen und Vorführwagen der Marken...
gebrauchtwagen-neuwagen.at Volkswagen Vw Golf Vii Variant Gebrauchtwagen Kärnten Auto Händler Leasing Kaufen Börse Passat Autos Ford Skiurlaub
123 Kookaburra Australia Work And ch
St. Gallen
Wir bringen Dich nach Australien! Im Rahmen des Kookaburra Projekts organisieren wir Auslandaufenthalte für Handwerker und Bauarbeiter aus der Schweiz...
kookaburraaustralia.ch Australien Kookaburra Leben Australia Projekt Handwerker Dein Dich Abenteuer Deine Beratung Angebot Bauarbeiter Gratis Deutschland Deinem Unserem Grundkenntnisse Jobs Damit
124 SMBS University of Salzburg Ausbildung at
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
125 SMBS University of Salzburg Ausbildung at
Die SMBS University of Salzburg Business School in Salzburg, Österreich, ist spezialisiert auf postgraduale Lehrgänge und bietet als international renommierte...
126 Direkt Kommunikation Lebens-und Sozialberatung at
Ehrliche, humorvolle und authentische Kommunikation, Beratung, Mediation von und mit Anna Maria Michenthaler aus Villach...
lebensberatung-kaernten.com Anna Michenthaler Mariay
127 bieten Darlehen zwischen bestimmten Darlehen at
Kreditangebot für Firmen, Unternehmen und jeder Person von gutem Charakter kann seine Verpflichtungen mit einem erschwinglichen Preis von 3% entsprechen....
rue francfort
128 abc Sprachen Education ch
ABC-Sprachen steht für Individualität, Flexibilität und beste Lernerfolge. Die ausgebildeten und zertifizierten Fachkräfte unterrichten ausschliesslich in ihrer Muttersprache. Wählen oder...
abcsprachen.ch Halbprivatkurse Privat Sprachkafi Sprachtandem Konversationskurse Gruppenkurse Sprachen Diplomkurse Kurse Lehrkräfte English Abc Englisch Stolz Arbeitsplatz Fordern
129 Tierklinik Neusiedl Tierklinik Neusiedl Tierklinik Tierarzt at
Neusiedl am See
Therapiezentrum für Ganzheitsmedizin Das Hauptaufgabengebiet der Tierklinik NEUSIEDL ist es - gemeinsam mit unseren speziell ausgebildeten Tierärzten - für das Wohl...
tierklinik-neusiedl.at Neusiedl Notfall Tierklinik ärzte Tieres Ihres See Aktuell Gesundheit Leistungen + Team Fragen Vorsorgeuntersuchung Datenschutzerklärung Bildgebende
130 Prim. Dr. Harald Simader Internist Ärzte at
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
131 Prim. Dr. Harald Simader Internist Ärzte at
Erweiterte, risikoadaptierte Vorsorgeuntersuchungen mit Ultraschall, EKG, Lungenfunktion, Bestimmung des Knöchel-Arm-Index und der Pulswellengeschwindigkeit inklusive Labor in einer Stunde....
132 Dormis Ferienwohnungen Ferienhäuser at
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Book Apartment Companies How Additional Other Listing Affiliate Owners Policy Engine Program Deming Rome Submit London Worldwide Apartments
133 Dormis Ferienwohnungen Ferienhäuser at
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um den gemeinsamen Nutzen...
dormis.com/ Nginx Services Booking Apartment Book Listing Other Apartments Policy Program Companies Additional Engine Owners Affiliate Filter Welcome
134 Hotel Schloss Leopoldskron Hotel at
Als Schlosshotel am See ist Hotel Schloss Leopoldskron sowohl traumhaftes Luxushotel für Urlaub in Salzburg, als auch außergewöhnliche Eventlocation für...
schloss-leopoldskron.com/ Schloss Salzburg Leopoldskron Hotel Seminare Suiten Veranstaltungen Eventlocation Park Zimmer Events Konferenzen Heiraten Music Feiern Garten Max Traum Partner
135 HML Beleuchtung LED Beleuchtung at
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
hml-beleuchtung.at Beleuchtung Hml Led Küche Bad Produkte Schlafzimmer Garten Vorraumräume Datenschutzerklärung Büro Pool Spa
136 HML Beleuchtung LED Beleuchtung at
St. Gilgen
Handel mit LED Beleuchtung, Umrüstung auf LED Beleuchtung, Stromsparen...
137 Hörgeräte Berlin Hörgeräte at
Hornig Hörgeräte Berlin - Besuchen Sie uns und lassen Sie sich professionell beraten....
138 Schmidt Bio logisch Reinigung & ch
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
139 Schmidt Bio logisch Reinigung & ch
ERFOLG DURCH BIOLOGISCHE MASSNAHMEN Mit unserer umweltfreundlichen Handlungsweise in den Bereichen Reinigung, Gartenunterhalt und Gartenbau möchten wir einen Beitrag zu einer...
140 Kavalierhaus Klessheim - Eventlocation Eventlocation at
Die Eventlocation Kavalierhaus Klessheim in Salzburg bietet Veranstaltungsräume und Seminarräume zum Mieten oder Buchen für Veranstaltungen wie Firmenfeiern, Firmenveranstaltungen oder...
141 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
142 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
143 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
144 Gebrauchtwagen Neuwagen Jahreswagen Kärnten Gebrauchtwagenhandel at
Gebrauchtwagen Händler in Kärnten der Steiermark und Österreich suchen. Hier finden Sie Autos, Neuwagen und Jahreswagen sämtlicher Marken und Modelle....
145 Salon de Coiffure Coiffure ch
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
146 Salon de Coiffure Coiffure ch
Bonjour, je mappelle Concetta, je suis une Coiffeuse Styliste italienne. Les années me ont permis dacquérir des connaissances dans lindustrie...
147 Uniresidence Alloggi Studenti ch
Residenza con appartamenti arredati e climatizzati a Lugano vicino all Università . Appartamenti per studenti USI e SUPSI , lavoratori...
uniresidence.ch Appartamenti Uniresidence Lugano Studenti Contatto Usi Per Residenza Climatizzaticoppie Procedura Ammobiliati Assigned Punti
148 vita club Salzburg West Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Salzburg Gtgt Fitnessstudio Training Fitnesscenter Fitnessclub Fitness Ebenso Trainingsplan Beratung Plate Spinning
149 vita club Salzburg Nord Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Fitness Salzburg Fitnessclub Fitnessstudio Training Fitnesscenter Gtgt Spinning Power Sauna Ebenso Trainingsplan Gesundheitlichen
150 vita club Salzburg Süd Fintessstudio at
Der vita club, Salzburgs größtes Fitnesscenter und Fitnessclub mit Standorten in Salzburg und Mondsee bietet Beratung und Coaching für Ihre...
vitaclub.at/ Club Vita Rsaquo Mondsee Training Fitnessstudio Gtgt Fitness Salzburg Fitnesscenter Fitnessclub Coaching Spinning Yoga Geräte Gesundheitlichen Trainieren Ausdauertraining
151 Zusatzunterricht im Raum Zwettl Bildung und at
Mathematik, Physik, Softwareentwicklung, Netzwerktechnik, Systemtechnik Für Dich: Langfristig/Kurzfristig, Auffrischung/Notfallmanagement, Zusatzunterricht/Hausübungsbetreuung, Altlastbereinigung/Vorbereitung....
152 Private Geld Kreditgeber hier Darlehen ch
Postfinanzierung ist eine amerikanische Privatkreditgesellschaft, die seit 1996 in den USA gegründet wurde und Finanzierungslösungen für alle Einzelpersonen, Firmen und...
privát pénz hitelező itt elérhető (nincs előtörlesztés)
153 Nebenjob Heimarbeit ch
Stellen Sie sich vor wie das wäre wenn Sie von zu Hause aus arbeiten könnten? Sie haben freie Zeiteinteilung. Leistungsgerechte...
gesundheitsplattform.ch Therapeuten Firmen Leute Arbeit Aging Qualifikation Schweiz Nahrungsergänzung Gesundheitsplattformch Vfg Gesundheitsplattform Spurenelement Tragen Fit Wellaging Antiaging Y
154 HTK-Vent - Spezialist für Industrieventilatoren at
HTK-Vent ist der Spezialist für Industrieventilatoren der Marke VENTUR in Österreich. Im Sortiment von HTK-Vent finden sich klassische Axial- und...
155 Alpaka Trekking am Berg Trekking ch
Alpaka, Lama und Esel Trekking auf dem Solothurner Jura oder wo immer Sie möchten oder zusammen mit den Alpakas in...
alpaka-am-berg.ch Alpaka Trekking Spass Tieren Herrmann Berg Lama Macht Jura Eseli Balmberg Erlebnis Esel Seit Alpaca Tiere
156 Erwin Leimlehner Fotografie Fotografie Hochzeitspanorama at
Hochzeitsfotografie mit 360° Hochzeitspanoramen, die als Bildschirmschoner oder in Web-Seiten eingebunden werden können. Auch virtuelle Touren durch interaktive 360° Panoramen....
leimi01.wixsite.com/leimlehner-foto Bildschirmschoner Hochzeitspanorama Hochzeitspanoramenhochzeitsfotografie Traumhochzeit Erlebnisfotografie Degpanorama Interaktive Deg Panoramenbilder Leimlehner Erwin
157 TCM Praxis ROTGOLD-Akupunktur Naturmedizin ch
Wikon / LU
Traditionelle chinesische Medizin / Naturmedizin Akupunktur Phytotherapie Moxibustion Schröpfen Massagen Ernährungstherapie Rejuvenation/Wirkungsvolle Verjüngungs-Akupunktur NOVALENICs Innovative naturmedizinische Galenik KOMPETENT & INDIVIDUELL SEIT 1998...
rotgold.info Akupunktur Gong Schröpfen Qi Tcm Moxibustion Kommunikation Rejuvenation Novalenic Philosophie Portrait Materia Naturmedizin Medica Kooperation Arzneien Verkauf
158 Hochzeitsmusik Hochzeitsmusiker Hochzeitsbands Hochzeitsmusiker Künstlerverzeichnis Musiker at
Sie planen eine Hochzeit, eine Party, ein Zeltfest, einen Ball oder eine andere Veranstaltung? Auf EinTollesFest.at finden Sie die passende Bands...
159 Detektivbüro Salzburg | Richard Detektei at
Detektiv Wallner ermittelt diskret, zuverlässig und professionell in jedem österreichischen Bundesland. Wir sind rund um die Uhr für Sie erreichbar...
detektei-wallner.at/ | Detektiv Wien Graz Baden Wallner Privatkunden Salzburg Kontrolle Geschäftskunden Richard Magiur Verbinden Jurist Patentrecht Außendienstes Häufige Apache
160 FUMAR.CH Zigarrengeschäft Tabakwaren ch
FUMAR.CH ist ein schweizer Fachgeschäft mit einem grossen Zigarrensortiment. Wir führen in unserem Online-Shop über 1000 verschiedene Zigarren und bieten...
fumar.ch Zigarren Entdecken Cutter Davidoff Pfeifen Aschenbecher Zigarre Zigarillos Partagas Julieta Tabak Feuerzeuge De Humidore Montecristo Herkunft Mexiko Aufbewahren Romeo
161 HÖLZL & HUBNER Gewerbeimmobilien Immobilien at
HÖLZL & HUBNER Immobilien bietet Anlageobjekte, Renditeobjekte sowie Gewerbeimmobilien in Salzburg. Als Gutachter erstellt HÖLZL & HUBNER Immobilienbewertung und Gutachten...
hh-immo.at/ Immobilien Hubner Hölzl Büros Gutachten Gewerbeimmobilien Wohnimmobilien Renditeobjekte Anlageobjekte Salzburg Gewerbe Wohnbaugrundstücke Unternehmen Hotels Geschäftslokale Miete Grundstück Büroräume Gastronomiehotels Objektsuche
162 Hypnosetherapie Hypnose Coaching ch
createyourself.ch Coaching Praxis Hypnosetherapie Hypnose Energie Beratung Alten Prozesse Angst Erfolg Wahrnehmung Hypnosetherapie Während Preis Thetafloating” Weiseverändern Beratung Wingwave
163 Psychosoziale Spitex Spitex Ambulante ch
Psychosoziale Spitex -Mehr als nur eine Begleitung Haben Sie gerade einen Klinikaufenthalt hinter sich und möchten nun eine professionelle und kompetente...
psychosoziale-spitex.ch Spitex Betreuung Professionelle Psychosoziale Unterstützung Zuhause Umgang Hause Einzelwohnen Angelina | Nachbetreuung Klinikaufenthalt Begleitetes Ort Alltag Leistungen Toggle Seifert
164 Wir schützen Ihre Werte Objektsicherheit Datacenter ch
Objektsicherheit plant, baut und betreibt Sicherheitsobjekte für Kunden in der ganzen Schweiz. Wir stehen als Spezialisten für alle Belange...
165 Elektrische Motorkarre Schiebetruhe Schubkarren. Garten at
Motorkarre mit Motor, verschiedene Ausführungen und Zubehör möglich- Schneeschild, Gabel, Schubkarre, Elektrofahrräder, Gartengeräte, Häcksler, Mini Dumper mit Elektroantrieb und mit...
bravoschubkarre.eu Motorkarre Mini Dumper Motorkarren Elektro € Elektrische Zubehör Benzinmotor Elektrofahrräder Komplettpreis Häcksler Ladeschalen Beschreibungen Katalog Download
166 Kinesiologe Bachblütenberater Persönlichkeitsanalyse Gesichter Kinesiologe Gesundheit at
Kinesiologie, Bachblütenberatung, Persönlichkeitsanalyse. Dient zum Stressabbau, Depression, völlige Erschöpfung, Managerkrankheiten, Allergien lösen....
lolawerkstatt.eu Z Meinewebsite Y
167 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
168 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
169 SV-Weber Sachverständiger Gutachter für Finanzierung Kredit at
SV-Weber Sachverständiger/Gutachter für Finanzierung, Kredit, Darlehen und Investition. Ausführliche Informationen unter, www.weber-gutachter.com...
170 Reinigung - Umzug - Reinigung ch
Unsere Erfahrung und ein ständig angepasstes Dienstleistungsangebot machen uns stark dafür, wenn es um bedarfsgerechte Lösungen, flexibles Zeitmanagement und kundenorientierte...
silver-reinigung.ch Reinigung Umzug Entsorgung Silver Reinigungsarbeiten Qualität Unternehmen Mengen Schnell Umzüge Kenntnisse Partner Zufriedenheit Galerie Spezialgeräten
171 Minnei Fotografie ch
Hobbyfotografin für Ihre Anlässe oder Tieraufnahmen...
172 Telefonanlagen und Telefonanschluss Shop Telekommunikation at
Im Shop von Telefonanlagen Lieferant finden sich ISDN & VoIP Telefonanlagen zum Kaufen sowie diverse Telefonanschlüsse, die dort beantragt werden...
telefonanlagen-lieferant.at/ Telefonanlagen Isdn Internet Telefonanschluss Panasonic Voip Telefon Cloud Telefonie Sms Provider Sip Ip Shop Beratung Businesskunden Voice Technologie Beratungs Check__
173 Studio Wimperntraum Wimpernverlängerungen Kosmetik at
Sie wollen einfach schöne Wimpern , dann ist Ihr Salon Wimpern-Traum in Berlin - Mariendorf Ihr kompetenter Experte...
wimpernverlaengerungen-berlin.de/ Wimpern Berlin Wimpernverlängerung Studio Wimpernwelle Schöne Lash Eyelash Einfach Wimpernverdichtung Technik Tempelhof Extensions Natur Auswahl Geschlossen
174 Bauerndörfl Rindereben - Ferien Tourismus at
Wer seinen Urlaub inmitten der traumhaften Naturkulisse des Nationalpark Hohe Tauern verbringen möchte, liegt mit dem Bauerndörfl Rindereben genau richtig....
rindereben.at/ Bauerndörfl Open Rindereben Hüttschlag Grossarltal Gallery Personen Feriendorf Bauernhof Berg Bauernhaus Angebote Großarltal Lage Ferienwohnung Gesund Advent Bio Blockhaus
175 Nature Adventure - Canyoning Outdoorsport at
Wir bieten geführte Outdoorsporttouren an und haben uns auf Canyoning, Rafting und Mountainbike spezialisiert. Zu Hause im Tiroler Lechtal, einer...
nature-adventure.at Canyoning Rafting Nature Adventure Lechtal Lech Programm Neuigkeiten Specials Tirol Galerie Bike Video Touren Mountain
176 Restaurant Nektar Restaurant ch
St Gallen
Persönlich-Gemütlich-Klein Ein paar Worte, die uns beschreiben sollen....
177 Sandra Wolkerstorfer - Psychotherapeutin Psychotherapie Linz at
Psychotherapeutin in Linz, Kinder- und Jugendpsychotherapie...
therapie-beratung.at Webseite … Archiv Wolkerstorfer Psychotherapeutische Praxis Psychotherapeutin Sandra Linz Ba Leistungen Beratung überspringen Erziehungsberatungpsychotherapie
178 Familien- und Vitalhotel Auenhof Hotel at
Herrlich ruhig und grün gelegen, bietet Ihnen unser Hotel Auenhof alle Möglichkeiten für einen traumhaften Familienurlaub im Stubaital in Tirol....
auenhof.at + Anreise Familien Vitalhotel Auenhof En Hotel@auenhofat Tiroler Geniessen Apache Auenhof****hotel Relax Wertvollsten
179 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
180 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
181 Salzburg Convention Bureau Eventveranstalter at
Venues und Locations für Events und Incentives in Salzburg. Das Salzburg Convention Bureau unterstützt bei Veranstaltungen wie Kongresse und Tagungen...
182 Dipl. Hypnosetherapeutin OMNI NGH Hypnosetherapie ch
Hypnosetherapie bei Stress, Gewichtsreduktion, Allergien, Ängsten, Chronischen Schmerzen, Sportlichen oder Beruflichen Zielsetzungen uvm. Ein starkes und glückliches Leben durch: MENTALE / EMOTIONALE...
hypnosetherapie-ld.ch Hypnose Stress Abnehmen Allergien Hypnosesitzung Schmerzen Diriwchter Hypnosetherapie Luzia Hypnosetherapeutin Bulimie Unterbewusstsein Praxis Themen Unruhe Patienten Essen Termin Finden Hilfe
183 Willkommen auf der Tigereye-mine.com Mineralien & at
Das Tigerauge gehört zu einem begehrten Schmuckstein, hat sich im Laufe der Jahre zu einem bei Esoterikern und Mineralienfans gleichermaßen...
tigereye-mine.com Tigers Mine Grades Order Mining Eye Also Avenue Florida Wholesale Order@tigereye Inc Minecomstates
184 Die fasziniernde Welt des Mineralien & at
In Osteuropa, im südlichen Kaukasus befindet sich die bisher einzigen, bedeutenden Vorkommen dieser Obsidian-Varietät. Auch andere Obsidian-Arten sind dort gefunden...
lamellenobsidian.com Lamellenobsidian Obsidian Heilstein Lamellen Form Obsidians Lace Midnight Gutachten Kristalle Gestein Anteile Besonderheit Bildergalerie Stck Hinsicht Bann
185 Handyzubehör und Handyersatzteile günstig Handyzubehör Mobiltelefonie ch
Reparatursets und die dazugehörigen Ersatzteile für Handys und Tablets gibt es nur im Schweizer Onlineshop andbox.ch. Zusätzlich bietet der Shop...
andbox.ch/ Apple Iphone Oem Galaxy Schwarz Xperia Samsung Plus Zubehör Sony Nexus Smartphone Hüllen Htc Reparatursets Usb Sticks Handyersatzteile Hörmuschel Kopfhörer
186 Bücheler Werbegeschenke AG Werbeartikel ch
Bücheler AG - Der Werbeartikel-Spezialist mit Werbeartikeln aller Art Streuartikel, edle Werbepräsente, Kundengeschenke, Give aways, Werbeartikel für Messen und Ausstellungen Ihre...
buecheler.ch Werbeartikel Bücheler Profi Werbegeschenke Etui Streuartikel Give Farben Kunststoff Sonnenbrille Flop Trinkflasche Tasse Wwwpromotrendsch Werbeartikelprofi Kundengeschenk Ipad Hülle Werbe
187 Babycenter Schweiz Baby-Produkte ch
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
188 Babycenter Schweiz Baby-Produkte ch
Das Babycenter Schweiz hat sich zum Ziel gesetzt, trendige und qualitativ hochwertige Baby-Produkte von den bekanntesten Herstellern zu fairen Preisen...
189 Institut für Logotherapie & Logotherapie at
Das Institut bietet bei der Ausbildung in Logotherapie und Existenzanalyse Lehrgänge für Lebensberatung und Sozialberatung und Imagination in Verbindung mit...
190 DDr. Gerlinde Tscharre Fachärztin Für at
191 DDr. Gerlinde Tscharre Fachärztin Für at
192 Dr. med. Natalie Reytan Hautarztpraxis at
Die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte bietet eine umfassende Bandbreite der generellen, operativen und ästhetischen Dermatologie...
hautarztpraxisberlin.de – Kosmetik Reytan Hautarztpraxis Dr Private Mitte Berlin Therapie Medizinische Akne Allgemein Kindern Hautarzt Hydrafacial™ Haare Fruchtsäure Teenie
193 empower-coaching Coaching ch
empower-coaching: loslassen, entspannen, Kraft schöpfen, einen Weg finden, sich vorbereiten Empower-coaching soll Ihnen helfen, mit einem akut erlebten oder bevorstehenden Ereignis...
empower-coaching.ch Kraft Praxis Schöpfen Kale Beratung Empower Coaching Fischer Loslassen Psychologische Energiesys­tem Kine­si­olo­gie Entspannen Psy­cholo­gie Etwas All­t­agein­set­zen Belastendes Mit­tels Peternbspfischer
194 TierTherapeuten LIGA Organisation ch
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Fachkreise Tiertherapeuten Tierhalterpublikum Therapeut Tierhalter Login Ausbildung Anbieter Mission Buchung Akupunktur Ligaisten Mäzenförderer
195 TierTherapeuten LIGA Organisation at
Die TierTherapeuten LIGA ist ein Zusammenschluss praktizierender TierTherapeuten sowie Anbieter tiergestützter Therapie (das Tier als Therapeut) ...
tt-liga.com Therapie Liga   Tiertherapeuten Fachkreise Tierhalterpublikum Login Therapeut Tierhalter Ausbildung Buchung Tiergestützte Anmeldung Mission Anbieter Anette Vision
196 24 Stunden Betreuung in 24 Stunden at
Wir vom Verein 24h-Assistenz-Pflege-Betreuung - APB möchten Ihnen einen unkomplizierten, zuverlässigen und kompetenten Service für Ihre 24-Stunden-Betreuung und Pflege bieten....
197 Foyer de Beaute Kosmetikstudio Kosmetik ch
Gesichtsbehandlungen Akne-Behandlung Anti-Aging-Behandlungen Pigmentflecken-Behandlungen Mikrodermabrasion Microneedling Mesotherapie Hyaluron / Filler Faltenunterspritzung Haarentfernung Laser Permanent Haarentfernung Wachs Maniküre Pediküre Massageanwendungen Tanning Selbstbräunung...
foyerdebeaute.ch Z Y
198 Informatik-Support& Beratung PC-Support & ch
Preiswert, ausgewiesen, kompetent und effizienter In formatiksupport. Ueber 20 Jahre Erfahrung. Daten sicherung, Datenrettung, Datenmigration, bei Neukauf, Computerhilfe und Computerschulung...
computer-arzt.ch Support Pc Mac Hilfe Informatiksupport Informatik Reparaturen Computer Windows Reparatur Schulung Apple Kompetener Erstellung Qualifizierter
199 Zahnarztpraxis Krebs Zahnarztpraxis ch
Der Zahnarzt Ulrich Krebs in Solingen steht seit Jahrzehnten und inzwischen in der 3. Generation, für einen qualifizierten und freudlichen...
zahnsolingen.de Ohligs Zahnarzt Solingen Zahnmedizin Implantologie Uns Leistungen Parodontologie Zahnarztpraxis Krebs Praxis Minimalinvasive Msc Ulrich Neuigkeiten Steht
200 Daniel Fuchs - Hotel Unternehmensberatung ch
Dr. Daniel G. Fuchs hat 35 Jahre Erfahrung in der Hotel und Ausbildungsbranche, Luxus und Gruppenhotellerie. Lehraufträge an diversen Universitäten...
danielgfuchs.ch/ Daniel Fuchs Services Pictures Michabout Unternehmensberatung Fotos Experte Hoteltourismus Dienstleistungen Contact Professorconsultant Lernveranstaltungen Business
201 Pfefferspray Store Sicherheit Selbstverteidigung ch
Schweizer Pfefferspray-Versand...
pfefferspray-store.ch Pfefferspray Pfefferpistolen Sabre Store Red Versandkosten Uns Agb Mk Mein Konto Jet Pfeffer Trainingswaffen Kartuschen Angel
202 Limousinen-mieten Limousinenservice ch
Wohlen AG
Stretch-Limousinen und Oldtimer finden Sie bei Kiwis Limousinen ltd. von über 25 Fahrzeugen mit 8 Standorten in der Deutsch-Schweiz vertreten....
stretch.ch Limo Limousinen Gästebuch Mieten Oldtimer Stretch Stretchlimo Limos Royce Rolls Zürich Limousine Basel Ab Luzern Rapperswil Jona Zug
203 Medientraining | Kommunikation Kommunikation ch
Training und Coaching Medientraining, Kommunikationstraining, Coaching Auftritt und Präsentation, Moderation von Workshops und Grossgruppen visuelle Kommunikation Ob Flyer, Infografik, Broschüre, Webseite, Jahresbericht...
204 Raum für Bewusstein und Hypnosetherapie -coaching ch
Systemische Hypnosetherapie /-Coaching. Hypnosystemisches LLC ® Hypnosetherapie - Schweizer Modell © ...Mental und Autogenes Training, lösungsorientiertem Kurzzeitcoaching uvm. zu einem wirksamen und...
zeitgerecht.ch Found Meditation Xidfound Not Guru Error Z
205 Beratung & Interim Management Unternehmensberatung at
Altenmark an der Triesting
Unternehmensberatung die den Ansprüchen von Lean Management gerecht wird. Durch unser Netzwerk an Spezialisten können wir mehrere Themenkomplexe abdecken und...
eccomp.biz Z Zeitpunkt Aufbaubitte Spteren Wwweccompbizdiese Webprsenz Under Currently Versuchen Einmalthis Constructionpleasebefindet Europe Host
206 Zahnarztpraxis Krebs Zahnarztpraxis at
Bereits seit Jahrzehnten bietet die Zahnarztpraxis Ulrich Krebs in Solingen versierte Zahnmedizin und eine richtiggehend vertraute Verbindung zu den Praxisbesuchern....
zahnsolingen.de Zahnarzt Ohligs Solingen Zahnmedizin Implantologie Uns Msc Minimalinvasive Parodontologie Ulrich Krebs Leistungen Praxis Zahnarztpraxis Patient
207 Loogo Umzüge Österreich Umzüge at
Mit LOOGO sparen Sie Zeit und Nerven. Überlassen Sie Ihren Umzug den Profis von LOOGO! Profitieren Sie von unserer Organisation und...
loogo.at Umzug Möbel Kartons Möbelküche * + Umzugsunternehmen Privatumzug Angebot Firmenumzug Verpackungsmaterial * Umzüge Loogo Kartons * Lkw * Internationaler Neumöbel Abholung Karton Rechner Demokratischevolksrepublikkorearepublikkroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmauretanienmauritiusmazedonienmexikomikronesienmoldawienmonacomongoleimontenegromosambikmyanmarnamibianaurunepalneuseelandnicaraguaniederlandenigernigerianiuenorwegenösterreichomanosttimorpakistanpalästinensischeautonomiegebie
208 RZA Business Software IT at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung....
209 RZA Business Software Software at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
210 RZA Business Software Software at
Die RZA Software & Business Solutions entwickelt intelligente Business Software für Rechnungswesen, Lohn- und Gehaltsverrechnung, Fakturierung, sowie eine einfache Registrierkassenlösung...
211 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
212 Chiptuning Softwaretuning Kfz Technik at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
213 Chiptuning Softwaretuning Kfz Technik at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
214 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
215 Chiptuning Softwaretuning Kfz at
CHIPTUNINNG-LEISTUNGSSTEIGERUNG CHIPTUNING-SOFTWARETUNING-OBD-TUNING Chiptuning vom Spezialist von Kärnten für ganz Österreich für alle Fahrzeuge Diesel, Benziner, mit oder ohne Turbo Partikelfilter...
216 Craniosacrale Körperarbeit silent touch Energetiker at
Praxis für Cranio-Sacrale Körperarbeit, silent touch, Aromalogie, Aromapflege, Arbeit mit dem morphogenetischen Feld Spezielle Angebote für Mutter und Kind, Säuglinge und...
gleichgewicht.jetzt Körperarbeit Grundsätze Gabriele Seitenanfang Craniosacrale Schelling System Finden Inhaltsverzeichnis Tiere Anwendungsgebiete Login Webtemplatedesign Mich Nächste Torsten Körper
217 Gebrauchte Stahlrohre von Ø219mm Handel Gebrauchte lu
Wrocław (Breslau)
Sehr geehrten Damen und Herren, wir bieten Ihnen die gebrauchten geschweißte Stahlrohre. Unser...
shimex.pl Z Y
218 VESPIX Wespen Notdienst KÄRNTEN Schädlingsbekämpfung at
VESPIX Wespen und Hornissen Notdienst in Kärnten!...
vespix.at Vespix Valid Wespen Klagenfurt Umsiedelungen Steinacher Wölfnitz Hornissen Preise Inhaber Kärnten Insektenbefall Wespenbekämpfung Stefan Xhtml Föhrengasse
219 Zehrer Bäckereibedarf at
Auf Zehrer finden Sie alles zum Backen: Backformen, Rollfondant, Massa Ticino, Ausstechformen, Hohlkörper, Hohlkugeln sowie Kuvertüre. Aber auch zur Tortendekoration...
220 Kundalini Yoga - Gong Yoga - ch
Der Amrit Yoga Verein fördert die Verbreitung von Kundalini Yoga, Karam Kriya (angewandte Numerologie), Yoga Coacing und Gong. Er organisiert...
221 Lampen und Kronleuchter Beleuchtung ch
Unser stetig wachsendes Angebot an schönen und hochwertigen Lampen aller Art garantiert Ihnen, dass Sie die für Sie passende Lampe...
traumlampen.ch Versand Kronleuchter Lampen Schweiz Lampe Swarovski Uns Agb Bleikristall Leuchtmittel Shabby Chic Finden Leuchter Kristall Stehlampen Deckenlampen Uhr
222 Gastrogeräte Küchengeräte Gastronomiezubehör ch
Günstige, qualitativ hochwertige Gastronomiegeräte, Küchenmaschinen, Pizzaöfen, Dönergrill, Küchengeräte, Kühltechnik sowie Outdoormöbel für Ihren Imbissbetrieb, Restaurant, Pizzeria, Partyservice, Catering oder Hotel....
gastrogeraete24.ch/ Versand Geht Unseren Pizzaöfen Finden Weinkühlschränke Uns Pizzaofen Teigknetmaschinen Beheizten Agb Gastronomiegeräte – Weinklimaschränke Vieles Hähnchengrill Zitruspressen
223 Gesamtprogramm für die Ophthalmologie Medizinaltechnik ch
Roggwil TG
Schweizer Gesamtanbieter ophthalmologischer, chirurgischer und diagnostischer Produkte für Augenärzte (Ophthalmologie), Optometristen und Augenoptiker....
mediconsult.ch/de Mediconsult Retina Glaukom Oct Erfahren Katarakt Diagnose Refraktion Ophthalmologie Hospital Anfahrt Vivinex Cornea Chirurgie Adresse Iol Kalkulation Ss Gesamtanbieter Refraktiv Plus Vitrektomie Scan
224 Yoga Aarau und Lenzburg Yoga Aarau und Lenzburg Yoga ch
Aarau / Lenzburg
Chantal Yoga bietet Yoga Kurse in Aarau und Lenzburg sowie SUP (Stand Up Paddling) Yoga auf dem Hallwilersee und anderweitigen...
chantalyoga.ch Yoga Aarau Lenzburg Flow Chantal Hallwilersee Vinyasa Erfahren Sup Mama Zeit Baby Teacher Training Schwangerschaftsyoga
225 Immobilien Florida Immobilienmakler Florida at
Haus kaufen Florida – Immobilien Naples, Bonita Springs, Marco, Ft Myers Beach, Sanibel, Cape Coral Suchmaschine für Immobilien Florida, aktuelle Angebote...
immobilienmakler-in-florida.com Florida Naples Immobilien Cape Coral Estero Sanibel Bonita Springs Marco Beach Myers Kirsten Island Fort
226 Pocketmania Online Marketing at
Ein Vergleichsportal für Pocket Bikes; Monetarisierung durch Affiliate Links...
pocketmania.de/ Pocket Bike Bikes Cross Dirtbike Renn Einzelheiten Amazon Preis Sieger Ebay Elektro ★ Prüfen Versandkosten Takt Max
227 Wagner Umzüge AG Umzugsfirmen ch
Wagner ist ein bekanntes Umzugsunternehmen im Raum Basel. Seit über 80 Jahren bietet das Unternehmen seine Dienste bereits an und...
wagner-movers.ch Gt Wagner Basel übersee Privatkunden Info@wagner Moversch Geschäftskunden Umzugsfirma Uns International Umzug Umzüge Geschichte Versicherung
228 Angela Hiltbrand Partnervermittlung ch
Angela Hiltbrand ist eine Partnervermittlungsagentur mit Büros in Basel, Luzern, Bern und Zürich. Mit Fingerspitzengefühl und gesundem Menschenverstand werden Menschen...
angela-hiltbrand.ch Error Errordocumentpermanently Theadditionally Moved Server Internal
229 M.A.N.D.U. Bad Ischl Fitness at
Bad Ischl
M.A.N.D.U. bietet individuelles Personal-Coaching, Kleiner Aufwand, großer Nutzen: Gestärkt und vital in den Alltag mit M.A.N.D.U. Your Lifestyleworkout! Kleiner Aufwand, großer...
mandu.at/standorte/bad-ischl Mandu Bad Ischl Standorte Upgradeeffizientes Browser Team Chrome Tauchen Ansprechpartnerin Petra Activate Ort
230 Redaktor-Online.de Dienstleistungen ch
Texte schreiben lassen Mehrere Personen brauchen eine kompetente Texte Schreiben Hilfe. Grundsätzlich verwundert das nicht. Vergessen wir jedoch nicht, dass...
redaktor-online.de Schreiben Kunden Redakteur Arbeit Hilfe Note Befriedigung Zufriedenheitsgrad Redakteure Bestellung Arbeit Bestellungen Bewerbung Aufträge Auträge Abgebrochenbestellungen Arbeitbestellungen Muster
231 Zahnarzt Zentrum fuer Hannover Zahnmedizin ch
Freuen Sie sich auf Ihren Aufenthalt in der freundlichen Praxisgemeinschaft des Zahnarzt Zentrum Hannover, die Sie im Herzen von Langenhagen...
zahnarzt-zentrum-hannover.de Rarr Zahnarzt Hannover Implantologie Zurück Zentrum Uns Zähne Termin Beratung Langenhagen Tag Patienteninformation Zahnseide Zahlt Leistungen
232 E+B Elektromaqschinen+Beratung A. Meyer Meyer Andreas ch
- Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschliesslich Retrofit. - Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung...
eund b.ch
233 E+B Elektromaqschinen+ Beratung A. Antriebstechnik Elektrisch ch
•Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschließlich Retrofit. • Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung und...
eundb.ch Entwicklung Elektromaschinenbau Drehzahlen Forschung Beratung Antriebe Werkzeugmaschinen Motorelemente Berechnung Spindel Hohe + Elektromaschinendienstleistung
234 Zahnarzt Zentrum fuer Hannover Zahnmedizin at
Für eine extensive zahnmedizinische Versorgung in Langenhagen steht Patienten die Praxisgemeinschaft des Zahnarzt Zentrum Hannover zur Verfügung. Die Praxis hat...
zahnarzt-zentrum-hannover.de Rarr Hannover Zahnarzt Uns Zurück Implantologie Zentrum Beratung Termin Zähne Langenhagen Angstpatienten Hand Scrollen Schienentherapie Wurzelbehandlung
235 Autohaus Moritz fuer Honda Autohaus ch
Erleben Sie kompetente Kundenbetreuung und Verlässlichkeit im Autohaus Moritz, das bereits seit mehr als 40 Jahren einen netten und fairen...
autohaus-moritz.de Honda Hannover Autohaus Hyundai Springe Moritzde Info@autohaus Moritz Gebrauchtfahrzeuge Laatzen Neuwagen Zurück Ihrem Großes Unser Fahrzeuge Fahrzeug
236 Autohaus Moritz fuer Honda Autohaus at
Hannover Laatzen
Das Autohaus Moritz steht seit mehr als 40 Jahren für nette, seriöse Kundenberatung, Sachkenntnis und Zuverlässigkeit unter dem Leitspruch...
autohaus-moritz.de Hannover Honda Autohaus Springe Hyundai Info@autohaus Moritzde Moritz Laatzen Gebrauchtfahrzeuge Unser Marketing Lackiererei Erlebnis
 Frühlingsfest Hauptuntersuchung
237 Elektronische und elektromechanische Antriebe Antriebstechnik ch
Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschließlich Retrofit. Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung und...
238 elektronische und elektromechanische Antriebe Elektrische Antriebstechnik ch
- Beratung von Antriebssystemen für elektronische und elektromechanische Antriebssysteme, einschliesslich Retrofit. - Erstellung von Antriebskonzepten für elektronische und elektromechanische Antriebssysteme. Beratung...
239 Hutter & Sohn - Installateur 24h at
Aschau im Zillertal
Wir sind Ihr verlässlicher Partner in Sachen Rohrbrüche, Verstopfungen und Wasserschäden, zudem bieten wir einen hauseigenen Service für Versicherungen! Unser Komplettpaket...
hutter-sohn.at Notdienst Rohrbruch Leistungen Service Ihr Uns Schimmelpilz Untersuchung Sohn Unser Kanalreinigung Downloads Versicherungen Verstopfung Privatkunden Profi
240 Lampen & Leuchten Großhandel Handel ch
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle aus verschiedenen Materialien...
maytoni.de Wholesale Chandeliers Crystal Lighting Modern Europe Street Classic Maytoni Manufacturer Loft Name Catalogue Diamant German Contact Login Invitation
241 Nicole Crestin Zahnarzt ch
La Chaux-de-Fonds
Mit über 30 Jahren Erfahrung bietet die SSO-Zahnärztin Nicole Crestin neben dem SBB-Bahnhof in La Chaux-de-Fonds im Kanton Neuenburg (Neuchâtel)...
242 Naturheilpraktikerin WAM Naturheilkunde - ch
Rickenbach LU
Meine Therapie-Schwerpunkte: • Blutegeltherapie • Orthomolekulare Medizin (Therapeutisch eingesetzte Mikronährstoffe) • Phytotherapie • Ernährungsberatung (Dr. Coy - Anti-Krebs-Ernährung; metabolic balance, etc.) Das dürfen Sie in meiner Praxis erwarten: • Fachkompetenz: langjährige...
naturheilpraxis1a.ch Blutegeltherapie Diagnostik Angebot Therapie Behandlungspläne Krankenkassen Naturheilpraxisa Preise Presse Naturheilkunde Praxis Rickenbach Geering Dipl Naturheilpraxisach Zuber News
243 Tourismusverband Region Hall-Wattens Tourismusverband at
Hall in Tirol
Verbringen Sie Ihren Urlaub in Tirol in Österreich und genießen Sie zahlreiche Aktivitäten auf den Bergen, in der Natur und...
hall-wattens.at/ Hall Region Swarovski Haller Winter Urlaub Geschichte Tirol Wattens Sommer Unterkünfte Wandern Essen Nordic Sehenswürdigkeiten Incentive Angebote Kulinarik Sport Events Filmteams Klumperspaß Wellness
244 Heiler und Heilpraktiker für Gesundheit ch
Heiler / Naturheiler Werner Münch ist ein besonderer Mensch mit einem außergewöhnlichen Lebenslauf. Er arbeitet viele Jahre als Realschullehrer, bis...
manualmedizin.de Heiler Naturheiler Münch Manuale Werner Kraft Medizin Jahre Bücher Therapie Patienten Wordpress Selbstheilungskräfte Mensch Seele Mich Skeptiker
245 Graphologie Dienstleistungen Personalberatung ch
Graphologie und Handwriting-Assessments®, die einfache und umfassende Lösung zur Einschätzung einer Persönlichkeit. Hier finden Sie allgemeine Informationen über die Graphologie...
grapho.ch Graphologie Handwriting Homepage Informationen Assessment Zurück Uumlber Gtltbr Angebot Auftrag Anliegen Hauptmenü Kandidat Angeboten Finden Gtauf Laufbahn Website Personalentwicklung Handschriftendeutung Spycher
246 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
247 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
248 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
249 Hochzeitsfotograf Zentralschweiz Hochzeitsfotografie ch
Ich bin Edi, euer Hochzeitsfotograf für Zeitlose und unauffällige Hochzeitsbilder. Wenn ihr euch in 30, 40 oder noch mehr Jahren...
250 Gasthof Hotel Grünauerhof Tourismus at
Wals bei Salzburg
Gasthof und Hotel Grünauerhof in Wals bei Salzburg - Ihr Seminarhotel mit eigenem Restaurant im Salzburger Land. Die Unterkunft ist...
gruenauerhof.com/ Hotel Restaurant Wals Salzburg
251 Torostone GmbH Geschenke Gravuren ch
St. Gallen
Torostone GmbH ist ein innovatives Handels- und Produktionsunternehmen mit Hauptsitz in St. Gallen und einem Büro mit Produktion in Sirnach...
torostone.ch/ Geschenke Stempel Gravuren Torostone Partner Hauptsitz Thurgau Niederlassung Gallen St Sirnach Ihrz
252 Schwerthaus Wald ZH Restaurants ch
Die italienische Küche ist weltberühmt - und das nicht nur für ein Gericht, wie es bei vielen anderen Nationen der...
schwerthaus.ch Pesci Menükarte Kinderkarte Pasta Carni Event Dessert Pizze Reservierung Schwerthaustischreservierung | Galerie Anfahrt Z
253 Alpha Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
254 Alpha Gravuren Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
255 Alpha Gravuren Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
256 Alpha Gravuren Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
257 Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
258 Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
259 Gravuren Gravuren und ch
Wir sind ein junges Team mit viel Erfahrung und Kompetenz. Wir erstellen sämtliche Beschriftungen für den innen und Aussenbereiche. Unsere Hauptgebiete sind: –...
260 Dr. med. Natalie Reytan Gesundheit ch
In der Mitte Berlins kann eine breit gefächerte Palette der allgemeinen, operativen und ästhetischen Dermatologie bei der privaten Praxis für...
hautarztpraxisberlin.de – Hautarztpraxis Kosmetik Kindern Akne Allgemein Therapie Hautcheck Hydrafacial™ Glykolpeeling Reytan Berlin Fruchtsäure Md Uns Med Unserer Fotodokumentation
261 VISUELLE FABRIK – Corporate Grafik Design ch
Komplettlösungen im visuellen Bereich – Grafik Design aus Basel (Schweiz) – Visuelle Fabrik: Grafik Design, Corporate Design, Webdesign, Visuelle Kommunikation...
visuellefabrik.ch Design Visuelle – Portfolio Fabrik Corporate Dienstleistungen Communication Visuellen Grafik Roman Pinterestbasel Komplettlösungen
262 Biogena Mikronährstoffe und Nahrungsergänzung Nahrungsergänzungsmittel at
Vitamine, Mineralstoffe und Spurenelemente abdecken: Biogena ist österreichischer Hersteller von Nahrungsergänzungsmitteln sowie Mikronährstoffpräparaten und auch vegetarische und vegane Kapseln ohne...
263 Biogena Mikronährstoffe und Nahrungsergänzung Nahrungsergänzungsmittel at
Vitamine, Mineralstoffe und Spurenelemente abdecken: Biogena ist österreichischer Hersteller von Nahrungsergänzungsmitteln sowie Mikronährstoffpräparaten und auch vegetarische und vegane Kapseln ohne...
264 Psychotherapie Luzern Psychotherapie ch
Suchen Sie Hilfe: Daniel Kaeser, eidg. dipl. Fachpsychologe für Psychotherapie bietet Ihnen Psychotherapie in Luzern an. Psychotherapie ist eine besondere Art...
luzerner-psychotherapie.ch Psychotherapie Daniel Luzern Kaeser Psychotherapeut Coaching Luzerner Psychologe Sbap Praxis Therapie – Meine Paartherapie Kosten Telefon Eidg Zsbbern
265 LOCAL Restaurant Bäckerei ch
Local befindet sich in nächster Nähe zum Bahnhof mitten in der Stadt Lenzburg. Ein einmaliges kulinarisches Erlebnis zum Verweilen und...
local-group.ch Local Group Wohlen Offene Lenzburg Stellen Front Mitarbeiter Hotels Seengen Info@local Groupch Schutz Show Unterdorfstrasse Ch } {locationname Erlebnis Apartments
266 White Collar Massmode Massmode Massbekleidung ch
White Collar Massmode ist Ihr Spezialist für individuelle Massmode und Massbekleidung. Wir fertigen Ihren persönlichen, auf Ihre Masse zugeschnittenen Massanzug...
whitecollar.ch Accessoires Schweiz Krawatten Manschettenknöpfe Einstecktücher Mass White Anzug Massmode Collar Whitecollarch Anzugshose Tuxedo Massgeschneiderte Krawattenhalter Masshemd Massanzug Apache
267 Gesundheitsmassage Massage ch
In der heutigen Zeit wo Stress und Hektik vorherrschen, ist es für viele von uns immer schwieriger geworden, Zeit und...
corinnesmassagerueuemli.ch Massagerüümli Massage Ausbildung Methode Preise Mich Dorn Powerstrips Gutschein Fgxpress Gästebuch Geschenk Reset Shop öffnungszeiten Auszeit
268 Ihre Homepage von Profis Werbeagentur und at
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
salzburg.software Webshop  » Domain Informationen Hosting Marketing Beratung Firma Support Produkte Cloud Homepageblog Menü
269 Ihre Homepage von Profis Werbeagentur und at
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
270 Ihre Homepage von Profis Werbeagentur und at
salzburgSOFTWARE bietet professionelle Homepages, Marketing und Training. Innovation durch Information. Mehrwert durch Wissen, Kreativität und Talent....
271 Mediations-Supervision Mediation ch
Supervision dient der Reflexion des beruflichen Handelns und versteht sich zudem als Beratungs- und Weiterbildungsangebot. Im Zentrum steht die Verbesserung...
fredhaslimann.ch Z Y
272 AUTO-KOHL Autowerkstatt und Abschleppdienst Autowerkstatt Abschleppdienst at
Seit 1991 bietet die Firma Auto Kohl GmbH einen Komplettservice rund ums Fahrzeug: Abschleppdienst und Pannenhilfe im Auftrag des ADAC...
autokohl.de Abschleppdienst Auto Kohl Erfahren Erlangen Adac Reifenservice Unfallinstandsetzung Pannenservice Huau Instandhaltungsarbeiten Inspektionen Verschleißreparaturen ✔ Klima Pannenhilfe
273 Ansteck-Buttons für jeden Anlass Grafik Werbung ch
Schwarzenberg LU
Mit Ansteck-Buttons werben Sie effizienter für Ihre Firma als mit einem Inserat - Garantiert! Denn Buttons sind günstiger und erreichen...
buttonz.ch Z Y
274 Tanja Obersteiner Bowen - at
tanjaobersteiner.at   Bowen Technik Termin Wen Anwendungsgebiete Michtanjaobersteiners Webseite  die Originale
275 Autolampen & Autobatterien Autolampen & Autobatterien Autozubehör Autobeleuchtung ch
Als Schweizer online Grosshändler bieten wir auf carspoint.ch ein weites Portfolio an sofort verfügbaren Xenonbrennern, Halogenlampen, LED Leuchtmitteln und Glassockellampen...
carspoint.ch Ds Ww Hb Pw Leuchtmittel Dr Wyw Xenon Led Autobatterie Prw Rw Tw Cw Pyw Road Hyw
276 Software Xpandit Xpandit mobile Softwareentwicklung und ch
Seit mehr als 30 Jahren entwickelt und bietet Braso AG Software für Elektrounternehmen, Schaltanlagen- und Steuerungsbauer, HLKS-Unternehmen, Dienstleistungen, den Buchhandel...
braso.ch Xpandit Braso Hlks Software Planung Auftragsbearbeitung News Buchhaltung Support Projektkontrolle Mobile Kursdaten Lösungen Branchen Mitarbeiter Betriebe Cockpit
277 Heliotherm Wärmepumpentechnik Ges.m.bH Wärmepumpenhersteller at
Heliotherm produziert Wärmepumpen zum Heizen, Kühlen und zur Warmwasserbereitung. Das Produktspektrum umfasst: - Erdwärmepumpen mit Flachkollektor - Natural Technology Wärmepumpen - Solewärmepumpe - Luftwärmepumpen in...
heliotherm.com Wärmepumpen Wärmepumpe Heliotherm Erdwärmepumpe Luftwärmepumpe Entscheiden Weg Unabhängigkeit Partner Energien Videos Newsarchiv English Ob Lexikon Flachkollektor Luft
278 Akupunktur Yin Yang Medi Akupunktur ch
yinyangmedi.ch/tcm-zentrum-zollikofen Zollikofen Akupunktur Schröpfen Massage Therapie Yin Yang Schmerzen Stadt Behandelt Psychefrauenleiden Haut Tarife
279 LAN-Thermometer für Temperaturüberwachung Hersteller LAN-Thermometer at
http://www.lan-thermometer.de/ präsentiert: LAN-Thermometer für das präzise Temperatur Monitoring über Netzwerk oder Internet der Herstellermarke Didactum Mit dem LAN-Thermometer von Didactum kann die...
lan-thermometer.de Didactum Thermometer Lan Temperatur Monitoring Snmp Temperatursensor Temperaturüberwachung Sensoren Raumtemperatur Systems Security Thermometers Software Sms* Messen Google+ Kritischeereignisse Verfügbarkeit
280 LAN Thermometer von Didactum Hersteller LAN lu
Münster Deutschland
http://www.lan-thermometer.de/ präsentiert: LAN Thermometer für die Temperaturerfassung über TCP/IP Netzwerk des Herstellers Didactum Mit dem LAN-Thermometer des Herstellers Didactum kann die Temperatur...
lan-thermometer.de Didactum Thermometer Lan Temperatur Monitoring Raumtemperatur Temperaturüberwachung Snmp Sensoren Temperatursensor Security Systems Thermometers Sms* Lager Serverraumverursachter Temperaturnachweis Dateien Itangewiesen
281 SolidWorks Schulung Bildung ch
Feldkirchen Westerham
Erstellen Sie mit SolidWorks parametrische Zeichnungen wie ein Profi SolidWorks ist eine Software, die Ihnen zur Verfügung steht um Modelle und...
solidworks-schulung.de/kurse/ Solidworks Draftsight Video Tutorial Cad Schulungen Interconnect Pdm Abrunden Consulting Videotutorial | Linienskalierung Verbesserungsvorschläge Simulation Spalten“ Schulung
282 Institut für Gesundheit Gesundheit ch
Endermologie, LPG, Vitalfeldtherapie, Global Diagnostic, Ernährungsberatung, Nahrungsergänzungsmittel, Power Plate, Sanguinum, Stoffwechselkur, Entgiftung, Haaranalysen, Vitalstoffberatung, Ultraschall-Kavitation, Traditionelle Chinesische Medizin...
medshape.ch Medshape Shopabnehmen Medizin Betreute Institut Gesundheit Gesund Stoffwechselkur ästhetische Nachhaltigihrem Angebot Medizinisch
283 Günstige Zirbenspäne für Zirbenkissen Holzdekoration at
Zirbenflocken und Zirbenhackgut Luftgetrocknet, frisch gehobelt und gesiebt aus Österreich. All Inclusive Versand! Intensiver Zirbenholz Duft und Wirkung!...
zirbenspaene.at Wirkung Zirbe Zahlungsbedingungen Nachfüllen Zirbenkissen Intensiver Liefer Gehobelt Günstige Luftgetrocknetzirbenspäne Zirbenhackgut Duft Gesiebt
284 Beamerlampen Projektorlampen Beamerlampen Projektorlampen Elektronikgrosshandel ch
Wir bieten Ihnen ein Komplettsortiment von Projektorlampen aller Projektorhersteller. Zusätzlich zu unserem Angebot von über 1500 Beamerbirnen für mehr als...
beamerlampe24.ch Beamerlampen Beamer Projektoren Kaufen Ersatzlampe Beamerlampe Zahlungsmöglichkeiten Kompatibleregistrieren Neu Marke Befinden Warenkorb Originalherstellerlampen
285 Praxis für Physiotherapie Christian Physiotherapie - at
Jeder Mensch ist anders. Jeder Körper ist anders. Jede Therapie ist anders! Daher steht am Anfang der Therapie ein ausführliches Gespräch...
physio-sobl.at Physiotherapie Therapie Meine Meilensteine Anfahrt Training Tarife Leistungen Massage Praxis Anders Linz Zielenentsprechen Mensch ist Rückenschmerzen
286 Nummernschildhalter Edelstahl Fahrzeugzubehör ch
Schwarzenberg LU
Die ZENURA (Zemp`s-Nummern-Rahmen) für Nummernschilder sind aus massivem Edelstahl gefertigt und werden seit 2007 in bester Qualität gefertigt. Egal ob Sie...
zenura-nummernrahmen.ch Z Y
287 Trigonorm - Regalsysteme und Lagerung ch
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
288 Trigonorm - Regalsysteme und Lagerung ch
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
289 Trigonorm - Regalsysteme und Lagerung ch
Unser flexibles TRIGO-Regalsystem steht für beste Qualität aus der Schweiz. Die enorme Anpassungsfähigkeit in allen Dimensionen, basierend auf einem Baukastenprinzip, ergeben...
290 Fensterkitt Computer Support PC Support ch
Der professionelle PC Support in der Region Biel Seeland. Seit 2003 lösen wir Computer Probleme unserer treuen Kundschaft. Egal ob...
fensterkitt.ch Support Version Windows Computer Linux Fensterkitt Viren Canonical Seeland Hilfe Microsoft Pc Services Jahren Betriebssystem Scammer Bot Armee
291 Top Pools Kärnten und Pool Schwimmbad at
Maria Saal
Polypropylenpool, Folienpool, Schwimmteich, Naturpool, Pool-Überdachung, Planung, Beratung und Pool-Bau! Ihr Poolspezialist für Kärnten und Steiermark!...
toppools.at Wasseraufbereitung Technik Pools Naturpools Folienbecken Kärnten Chlor Toppools Ozon Admin Posted Reinigung Polypropylen Poolüberdachung Investition Poolbedarf Einbauteilentechnik
292 Familienstellen Systemisches Stellen Persönlichkeitsentwicklung Coaching ch
Claudia Honegger, Systemische Lösungen, Familienstellen, Systemisches Stellen, Einzel- und Gruppenaufstellungen in Elsau, Winterthur, Matrix, Achtung - Lösung - Los, Symptome...
293 IT Lösungen EDV ch
Flexible und schnelle Lösungen. Damit Sie Ihre Zeit nicht dafür aufwenden müssen IT-Probleme zu lösen, Prozesse zu optimieren und Ihr...
itservices-kmu.ch/ Support Server Netzwerk Blog Informationen Produkte Dienstleistung Menü Archiv Services Helpdesk Hilfe Digital Starken Servicehilfe Telefon Verlassen Bieten
294 BKOS GMBH Bau ch
BKOS GMBH ist spezialisiert auf Betonkosmetik, Graffitischutz, Oberflächenschutz und Spezialreinigungen. Dabei stehen insbesondere Naturstein und Sichtbetonflächen im Fokus. Wir haben...
bkos.ch Betonkosmetik Graffitischutz Jobs Zh * Dienstleistungen Betonreinigung Betonschutz Passwort Jona Naturstein Bkos Stäfa Benutzername Sg * Uns Ihreoberfläche Serviceleistungbei Homebauten Algenschutz
295 Hypnose Zentrum Köln Gesundheit ch
Das Hypnose Zentrum Köln, ganz mitten im Zentrum der Metropol-Region Köln, Düsseldorf und Bonn hat sich darauf spezialisiert seine Klienten...
hypnose-zentrum-koeln.de Hypnose Köln Erfahren Angeboten Abnehmen Selbsthypnose Rauchen Selbstvertrauen Coaching Ausbildung Selbstbewusstsein Zentrum Dank Selbstbewusster Raucherentwöhnung
296 Übersetzungen Korrekturen und Lektorate Dienstleistung ch
St. Gallen
Wir empfehlen uns für Übersetzungen, Korrekturen und Lektorate in jeder Fachrichtung und jeder gängigen Weltsprache. Dank einem grossen Netz an...
wettstein-uebersetzungen.ch Wettstein Lektorate übersetzungen Korrekturen Contact Kompetent Mitarbeiter Gericht Uebersetzungen Konsulat Schnell Beglaubigungen Dienstleistungen Weltsprachen Anerkannt Gerne Auch Unternehmensbroschüre
297 LAN Thermometer vom Hersteller Hersteller at
Muenster Deutschland
http://www.lan-thermometer.de präsentiert: LAN-Thermometer für die Messung und Überwachung der Temperatur in wichtigen Räumen. Didactum, Hersteller von IT Überwachungssystemen, hat mit dem...
lan-thermometer.de/ Didactum Thermometer Lan Temperatur Monitoring Sensoren Snmp Temperatursensor Temperaturüberwachung Raumtemperatur Security Thermometers Systems Netzwerk Temperaturaufzeichnung Klimaanlage Unternehmenlahmlegen Räumen Temperaturprotokoll
298 Praxis für Psychotherapie und Psychotherapie at
Psychotherapeutische Krankenbehandlung und Gesundheitserhaltung. Psychotherapie in Linz. Burnout, Depressionen, Ängste, Krisen, etc....
rme.or.at Psychotherapie Training Beratung Coaching Punkt Mayer Exner Praxis Team Ziele Wahrnehmung Biografie Männer Perspektiven Platz Tiefenpsychologische
299 3 Stück Chefsessel Büromöbel at
Verkaufe 3 Stück Büro-Drehstühle ( auch einzel ). Marke : Röder 1x Lehnenhöhe 80cm, 2x Lehnenhöhe 60cm; Sitzbreite, Sitztiefe 50cm; 5 Rollen...
300 Fluorfreie Imprägnierung Imprägnierung ch
IMPREGNO ist ein PFC-freies Hydrophobiermittel zur Langzeitimprägnierung für die Anwendung auf Textilien, insbesondere für Outdoor-Artikel, Stein, Holz, Leder oder Kunststoff. IMPREGNO-Imprägnierung...
impregno.ch Impregno Imprägniermittel Shop Imprägnieren Schuhe Imprägnierspray Imprägnierung Oberflächen Datenschutzbelehrung Holz Wash Fragen Mail@impregnoch Direkt Zusatz

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Vers-l'Eglise

+ Kommentar oder Kleinanzeige für Vers-l'Eglise eintragen!

301 Accueil

302 FBLOCATION Massongex
... Massongex Tél. + + Natel + E
fb-location.ch Massongex Massongex Location Location Massongex
303 Ballina
Massongex Schweiz

304 Mobival

305 ACCUEIL Restaurant Le ACCUEIL
Les Mosses
Hôtel Belair Leysin. Eté comme hiver le point de départ idéal pour vos activités ... Restaurant Le Chaussy - Rte du Col des Mosses - Les Mosses - Suisse+ - Contact
abcom.ch ACCUEIL
306 Excursion motoneige Canada Québec Randonnée
Les Mosses
Motoneige Quebec Excursion en motoneige. ... cette passion ! Suisse St-à lie-aventures Les cartiers Les Mosses Tà là phone +
motoneigequebec.ch Randonnée En Motoneige Sur Les Sentiers Balisés En
307 Accueil
Les Diablerets
... du Col de la Croix case postale Les Diablerets Où nous trouver ? Copyright Tennis Club
308 Bienvenue aux Lilas Hôtel
Les Diablerets
Hôtel de charme dans un petit chalet au grand confort aux Diablerets dans les
les-lilas.ch Hôtel Hébergement Auberge Pension
Les Diablerets
Ziel der Nationalen Leistungszentren Mitte (Engelberg) West (Brig) und Ost (Davos) ist es
310 Difaco Sàrl: Construction de
Les Diablerets
... Appartements . pièces DIFACO S.à.r.l Route Royale Les Diablerets Tél.
311 Accueil iMoullet Architecture Sàrl Architecte
Les Diablerets
Présentation de mon bureau d'architecture créé en avril 2010
imoullet.ch Architecte Bureau D'architecture Cabinet D'architecture
312 Agence BAUMA immobilier immobilier
Les Diablerets
Real Estate Brokerage
bauma-immobilier.ch Immobilier Real Estate Propriété Property Properties Vaud Suisse
313 Ecoeur Frères s.a. |
Société fondée en 1970 présente dans le domaine de sanitaire chauffage piscine ... Bois-Pellet Réalisations Contact Contact Dépannage Ecoeur Frères s.a. - Rue St-Didier -
314 Institut Tant d'instants
Institut Tant d'Instants massage réflexologie beauté des pieds épilation à Collombey
315 L'Autre Paysage sàrl paysage
L'Autre Paysage sàrl le paysage de vos rêves. L'Autre Paysage sàrl s'occupe du design
lautrepaysage.ch Paysage Paysagiste Chablais Monthey
316 Pharmacie des Puits Pharmacie
Bienvenue sur le site de la Pharmacie des Puits à Collombey. Grâce à une équipe ... Pharmaciennes Rue des Dents-du-Midi B CH - COLLOMBEY Tél + +
pharmaciedespuits.ch Pharmacie Des Puits Collombey Muraz
317 BK Isolations Entreprise Isolation

bkisolations.ch Isolation Calorifugeur Thermique Frigorifique Phonique Suisse Valais
318 Site officiel de la Fanfare
Bienvenue sur le site officiel de la fanfare les colombes collombey : son histoire ... pour le juillet à Fanfare Les Colombes – Case postale – Collombey Informations
colombes.ch Fanfare Colombes Collombey Musique
319 Immobilier Chablais Valais immobilier

immologer.ch Immobilier Suisse Chalet Chalets
320 Univers Cuisines Piatti dans Univers
Vous désirez changer votre cuisine ? Vous aimeriez renouveler vos équipements ? Pensez à visiter
universcuisines.ch Univers Cuisines Chablais Vaud Valais
321 Accueil

322 CollombeyMuraz :: Commune de CollombeyMuraz
En descendant le cours du Rhône après le défilé de SaintMaurice la vallée ... -du-Midi Case postale Collombey + + Horaires d'ouverture de
illarsaz.ch CollombeyMuraz En Descendant Le Cours Du Rhône
323 Accueil
... Swiss Equi Services SA Esserton Collombey Valais Tél +
324 La Villageoise de Muraz
Site officiel de la Fanfare
325 HM Constructions Architecture

326 JB Montage jb
Collombey - Muraz
JB Montage
jbmontage.ch Jb Montage
327 Diagnostic Amiante Fribourg

328 Diagnostic Amiante Oron

329 Diagnostic Amiante Nyon

330 Diagnostic Amiante Montreux

331 Diagnostic Amiante Aigle

332 Diagnostic Amiante Payerne

333 Diagnostic Amiante Moudon

334 Diagnostic Amiante Avenches

335 Diagnostic Amiante Ollon

336 Diagnostic Amiante Prilly

337 Diagnostic Amiante Valais

338 Diagnostic Amiante Gland

339 Diagnostic Amiante Pully

340 Diagnostic Amiante Genève

341 Diagnostic Amiante Renens

342 Diagnostic Amiante Vaud

343 Diagnostic Amiante Vevey

344 Diagnostic Amiante Morges

345 Diagnostic Amiante Jura

346 Accueil | Ecofontaine.ch
... Fontenailles St-Triphon VD Suisse N° tél + fischedagmail Contactez
347 EnVie Association de EnVie

en-vie.ch EnVie En Vie Envie Association
348 Service Sols

349 FSG Ollon/StTriphon gymnastique

fsg-ollon.ch Gymnastique Société De Gymnastique Ollon/StTriphon
350 Accueil | Tecnat SA Laménagement
Tecnat vous invite à visiter son site et à découvrir ses activités dans les domaines ... l'environnement et de l'aménagement du territoire. Contact Tecnat SA En la Porte St-Triphon Suisse Tél
tecnat.ch Laménagement Lenvironnement Territoire  tecnat
351 Olivier Estoppey | Artiste sculpture
Ollon VD
Olivier Estoppey est un artiste sculpteur prolifique ses idées ont peu de limites. Chacune ... décembre à heures Gymnase de Beaulieu Hall du bâtiment principal Rue du Maupas CH- Lausanne
olivier-estoppey.ch Sculpture Scuplteur Art Artiste Loup Oeuvre Oeuvres Oie
352 Le vin Vente Vente
Vente de vins | Grands crus et petites productions | Acheter Commander vins grands crus ... -nous Vinentia Sàrl Rue de la Chapelle Ollon Tél. Vinentia
vins-francais.ch Vente De Vins | Grands Crus Et Petites
353 AVO | Artisans Vignerons vin
AVO Artisans Vignerons Ollon. Un terroir Une légende... Découvrez l'histoire et les vins ... vos envies. En savoir plus Service Livraison Artisans Vignerons d'Ollon Rue Demesse - CP -
avollon.ch Vin Suisse Vins Suisse Vin Vaudois
354 ImmoCastle SA Accueil

355 Thérapies psychocorporelles Carole
bienvenue sur le site corps et sens différentes thérapies psychocorporelles mon approche est ... remboursée Je vous reçois à deux adresses Chemin de la Roche Ollon et à Vevey + ..
356 Accueil coach
accueil du site www.gcoach.ch ... "Espace temps" Me contacter Giuliana Giorgianni Ch. des Arnoux Ollon + E-mail Cette
gcoach.ch Coach Professionnel Coach Personnel Coach
357 C.T.I. Médical Location mobilisation
Ollon VD
Efficace et proche de vous. Mobilisezvous! L?efficacité des attelles de mobilisation est prouvée par les ... contacter et louer C.T.I. médical Sàrl Chemin des Truits Ollon Voir un plan Contact Tél
locationkine.ch Mobilisation électrothérapie Contacter Location
358 Menuiserie Gilles Bollschweiler
Depuis 20 ans la menuiserie Bollschweiler met un point d'honneur à satisfaire de manière ... la hauteur. Partenaires Contact Bollschweiler Associés SA Route de Panex CH- Ollon T (
359 Aigle Autoécole l'obtention aigle
Aigle Autoécole l'obtention de votre permis de conduire AutoMoto à Aigle et en Valais ... Aigle Bienvenue sur www.Aigle-autoecole. Nous sommes à votre disposition pour vous
aigle-autoecole.ch Aigle Suisse Autoecole Auto Ecole
360 Www.Elnox.ch

361 Accueil equi

equi-chablais.ch Equi Chablais
362 Boulangerie Peppicelli: Votre artisanboulanger
... budget. Boulangerie Pâtisserie Tea-Room Kiosque Peppicelli - Ch. de la Planchette Rue du Midi
363 Centre Biblique Librairie

364 Michelangelo SARL Michelangelo
Michelangelo SARL ... Michelangelo Chemin des Lieugex Aigle TÃ l. miche.ange
miche-ange.ch Michelangelo SARL
365 Home carrosserienouvelle
Home ... particulièrement élevés Carrosserie Nouvelle Chemin des artisans Aigle Tél info
366 Bienvenue sur le site hygiene
ASEMA ... Websolaire Notre site Internet fonctionne à l'énergie solaire ASEMA Avenue des Glariers Aigle
asema.ch Hygiene Personnelle Deplacement Transfert Positionnement
367 ASCO Assurances ::Aigle:: ASCO
Website de ASCO Assurances à Aigle
asco-assurances.ch ASCO Assurances Assurance Entreprise
368 Atlantic Limousines Location limousine
Location de limousines et voitures d'exception avec chauffeur.
atlantic-limousines.ch Limousine Limousines Mariage Mariages
369 ECC
... Chœur a bravé le froid mordant pour s'en aller réchauffer les cœurs des résidents du Foyer Saint
370 EPOC: La police du
... Place du Marché Case postale Aigle Tél Ouverture h? j/ Poste de
371 FidAlp Fiduciaire Fiduciary Fiduciaire
... d'entreprise Services pour personnes étrangères FIdALP Fiduciaire Case postale Rue de la Gare CH-
fidalp.ch Fiduciaire Comptabilité Fiscalité Révision
372 François Nicolier Agencement |

373 Stores Chablais SA
... Giddey et Fils Fabrique de stores SA Rte Industrielle Aigle Tél ..
374 SP CONSEILS Un spconseil
SP CONSEILS Un seul interlocuteur pour toutes vos assurances à Aigle. Helsana ... du Bourg - Aigle - Tél. - - infospconseils
spconseils.ch Spconseil Sp Conseil Assurance Courtier
375 Bienvenue sur Lodge Lodge
Lodge sàrl
infolodge.ch Lodge Infolodge Vente Management De
377 Accueil

378 Plateformes Elévatrice : neuves plateforme
Vente de machines neuves et d'occasion : plateformes élévatrices nacelles automotrices sur véhicule
nacelles-elevatrices.ch Plateforme Nacelle Véhicule Arraignée
379 PhotoClub Aigle | Club photo
Club des passionnés de la photo dans la région du Chablais
photoclub-aigle.ch Photo Club Photographie Galerie
380 Une boucherie un boucherie

reichenbach-paradis-saveurs.ch Boucherie Reichenbach Aigle Spécialités Vaudoises Saucisses
381 Trottinette Festival du trottinette
Trottinette Festival Romand du spectacle pour enfants
trottinette.ch Trottinette Festival Romand Spectacle
382 Home | sleep.ch touristika GmbH schweiz
Hotel Hotels buchen Ferienwohnung Urlaub in der Schweiz
sleep.ch Schweiz Hotel Schweiz Urlaub Günstige
383 Home

384 Vins du Chablais Stéphane
Stéphane Borter vigneron encaveur dans le chablais
borter-vins.ch Stéphane Borter Vigneron Encaveur Du Chablais
385 Accueil
... contacter pour toute question. Copyright . www.sw.ch All Rights Reserved.
386 Conseillère en communication
Corinne Moesching conseil en communication offre des services de contenu rédactionnel pour publireportage rapport
387 Location de chalet: Le chalet
Présentation d'un chalet de vacances au fond de la vallée de l'Etivaz en Suisse. Cadre
clos-ister.ch Chalet Etivaz Mosses Châteauxd'oex Location Vacances Hébergement Montagne
388 Celliers du Chablais
Les Celliers du Chablais des vins blancs rouges et rosé des membres de l?Association
389 Crausaz Construction SA crausaz
... Les Petits Pois Crausaz Construction SA Rue de la Fontaine CH - Aigle Tél.
crausaz-sa.ch Crausaz Construction Chantiers Travaux
390 Grau Electricité SA grau
Actifs dans les domaines de l'électricité les dépannages la domotique la téléphonie ... Electricité SA Rue Colomb Aigle Tél... .. Magasin de Monthey Grau
grau-electricite.ch Grau Grau électricité Grau SA
391 Futurekids
Futurekids offre à vos enfants d?entrer dans l?univers passionnant des sciences informatiques et de la
392 Efimex SA


394 Hôtel café Suisse

395 Home | sleep.ch touristika GmbH schweiz
Hotel Hotels buchen Ferienwohnung Urlaub in der Schweiz
hotelfinder.ch Schweiz Hotel Schweiz Urlaub Günstige
396 Jardibois Jardibois
jardibois.ch Jardibois
397 Aïkido Club Aigle | aïkido

aikidoaigle.ch Aïkido Aikido Shodokan Aigle
398 ADSA Chablais vaudois

399 Amiguetmartin l´Espace Bureautique SA Espace
Duplirex l'Espace Bureautique SA est un lien pour procurer un outil de travail IDEAL aux
amiguet-martin.ch Espace Bureautique Catalogue Professionnel Catalogue écoles
400 Abcvinsguillard.ch jeanmarc
Le site de JeanMarc Guillard vigneron encaveur à Aigle Suisse ... ces magnifiques étiquettes pour découvrir le vin ! Jean-Marc Guillard Chemin de Marjolin
abc-vinsguillard.ch Jeanmarc Guillard Guillard Vin Aigle
401 Vitalys.ch institut
Institut de beauté onglerie massage et soins du corps
vitalys.ch Institut Beauté Soin Visage
403 Présentation Boutique Anaïs lingerie
... Contact Plan de site Boutique Anaïs - Rue du Midi - Aigle - Tél. + - info(at
boutique-anais.ch Lingerie Fine Lingerie Soutiengorge Collant String Shorty Tanga
404 Dominique Girardet Menuiserie menuiserie
Créée en 1963 à Aigle l'entreprise Dominique Girardet est spécialisée dans la menuiserie et
dominiquegirardet.ch Menuiserie ébénisterie Volets Stores
405 Accueil Silke
Silke PAN sportive élite en paracyclisme. Une vie un carrière sportive un
silkepan.ch Silke PAN Handbike Handybike Marathon
406 Villa clara page

407 ECC
... Chœur a bravé le froid mordant pour s'en aller réchauffer les cœurs des résidents du Foyer Saint
408 Home | sleep.ch touristika GmbH schweiz
Hotel Hotels buchen Ferienwohnung Urlaub in der Schweiz
mountainholidays.ch Schweiz Hotel Schweiz Urlaub Günstige
409 DUPAUL shop Accueil

410 Bienvenue sur le Relais Suisse
Bienvenue au Relais du Château qui vous accueille dans un cadre agréable lors de votre ... - infobnb-aigle Chemin de Rochebord ? AIGLE
bnb-aigle.ch Suisse BB BnB Chambres D'hote
411 Centre dentaire de la vevey
Centre dentaire de la Tour Aigle cabinet dentaire Chablais dentiste Chablais dentiste ... Industrielle Aigle Tél. Cette adresse e-mail est protégée contre les robots spammeurs
centredentairedelatour.ch Vevey Montreux Villeneuve Villars Monthey Dentisterie Urgence
412 Chiropratie
... chiropraticien !!! Dr. A. Barras Ch. des Dents de Morcles Aigle Suisse +/.. Sign
Aigle VD
... Contact AdresseRue de la gare B Aigle TÃ l+ bureauhpsacher Notre
414 Bienvenue Armée du

415 Educafun Educa'Fun
Cours d'éducation canine en méthode positive. Harnais Animalin et articles Chuckit
416 Accueil PME Management

417 SDIS Chablais

StadtBranche.ch Orts-Portrait von Vers-l'Eglise in Waadt Schweiz. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Vers-l'Eglise erhält 4 StadtBranche.ch Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. - Stand: + Kontakt

Waadt ▪ 1864

Ormont-Dessus ist eine politische Gemeinde im Distrikt Aigle des Kantons Waadt in der Schweiz. Die früheren deutschen Namen Ormund und Ulmenthal werden heute nicht mehr verwendet. Der bekannteste Ortsteil ist das Feriendorf Les Diablerets.

Aigle Gare CFF1860
La Comballaz1862
La Forclaz1866
Le Sépey1863
Les Diablerets1865
Les Mosses1862